ORFeome > snai2 – XORFeome 2.0

snai2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis snail homolog 2, mRNA (cDNA clone MGC:89094 IMAGE:7006382), complete cds
Gene Symbol: snai2
Gene ID: 395065
ORF gb_acc: MG134095
ORF ID: 11719

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC075376

Library Location

Plate ID: GDExt11017
Well Location: E05

EST Sequences

Clone: MGC:89094 IMAGE:7006382
Trimmed Sequence: ATGCCACGATCTTTTCTGGTCAAGAAACACTTCAACTCGGCCAAAAAGCCCAATTACGGGGAGTTGGACAACCATACAGTGATCATCTCCCCATTCCTGTATGAGCGGTACCCTGTGTCTGTGCTACCCCAGCCTGAACTCTACAGCTCGGTGGCCTACAGCCCCATCACCGTGTGGACAGGACTGCTTCACCCACCACTGCCCAGCGATCTCTCCCCTCTCTCAGGATACCCTTCATCTTTAGGACGGGTCAGCCCCCCTCCGCAGTCGGACACGTCGTCTAAAGACCACAGTGGCTCGGAGAGCCCCATCAGCGATGAGGAGGAAAGACTCCAGACCAAACTTTGCGACTCACATGCAATAGAGGCTGAGAAGTTCCAGTGCAGCTTATGCAGCAAGACCTACTCTACTTTCTCTGGGTTGGCTAAGCACAAGCAGCTGCATTGCGACGCCCAGTCTAGAAAATCGTTTAGCTGCAAGTACTGTGAAAAGGAGTATGTGAGCCTGGGCGCGCTGAAGATGCACATCAGGACACACACTTTACCCTGCGTCTGTAAAATCTGCGGCAAAGCTTTTTCTAGGCCATGGCTACTACAAGGGCACATCCGCACTCACACTGGAGAGAAGCCCTTCTCATGTCCACACTGCAACAGAGCATTTGCAGACAGATCCAACTTGCGAGCCCACCTGCAGACCCATTCTGATGTGAAGAAATATCAATGCAAGAACTGTTCCAAAACCTTCTCTAGAATGTCGCTCCTTCACAAGCATGAGGAATCTGGTTGTTGTGTAGCACATTAG
Full Trace Sequence: cagggatcagcttgaggccggggaggaaactaaagtcgctccttgtgggacagttactttgccaggcttgggcaccggcactcctctctcccgcactgaaaatgccacgatcttttctggtcaagaaacacttcaactcggccaaaaagcccaattacggggagttggacaaccatacagtgatcatctccccattcctgtatgagcggtaccctgtgtctgtgctaccccagcctgaactctacagctcggtggcctacagccccatcaccgtgtggacaggactgcttcacccaccactgcccagcgatctctcccctctctcaggatacccttcatctttaggacgggtcagcccccctccgcagtcggacacgtcgtctaaagaccacagtggctcggagagccccatcagcgatgaggaggaaagactccagaccaaactttgcgactcacatgcaatagaggctgagaagttccagtgcagcttatgcagcaagacctactctactttctctgggttggctaagcacaagcagctgcattgcgacgcccagtctagaaaatcgtttagctgcaagtactgtgaaaaggagtatgtgagcctgggcgcgctgaagatgcacatcaggacacacactttaccctgcgtctgtaaaatctgcggcaaagctttttctaggccatggctactacaagggcacatccgcactcacactggagagaagcccttctcatgtccacactgcaacagagcatttgcagacagatccaacttgcgagcccacctgcagacccattctgatgtgaagaaatatcaatgcaagaactgttccaaaaccttctctagaatgtcgctccttcacaagcatgaggaatctggttgttgtgtagcacattagaccgtcatatgtttaccaggacttaacacatccttcagggtttctggtgtaaaagaaattccaaacatttttttcttacctctttttgttcctgttaaaggaaagcctatgcaagattcaccaaaaacaccagaatttcaggttcgatttgcagtatggattacaaataatagaaacacatttccatatggcaggaaggatcaatgaaatggtctttagcgatgccacatttccttgacatgtataaatcagatgcatatgtagagagcctagacaatccagcaacaatccaagcgactttcagcttcgttctcatgtgctttactaagtagcccatgagatcccttcttcctgaatcgatatgactcttaaactgtgccattcagtgtattgccattatttttagctaggctccatctgtgcctttgccagccattgccttcagacattccttggttttatttaagacttttacaaatttcacacagtaggattttttttaaataaaatttacaattttgttctcatgggaataagtgcaaccgagaggggtttaagtgaatgcgaaaatgtagatcctgaacttttcctatgcacaaaaaaaaatgcaactcattttcaggattctccacccttcatgtgcctttttttataataatttgtaaaatatgtgaatatattttgaaatgtttatatttttatatatgtgtgtgtgtgaatgtggcgtgtgaaagagagaagcagcaagttgccaattcagggataacttgaaatgatgtgccaatttgtttttcagatgcattttttaataaaccctttcgataaattttaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPRSFLVKKHFNSAKKPNYGELDNHTVIISPFLYERYPVSVLPQPELYSSVAYSPITVWTGLLHPPLPSDLSPLSGYPSSLGRVSPPPQSDTSSKDHSGSESPISDEEERLQTKLCDSHAIEAEKFQCSLCSKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCEKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH
Donor tissue: