ORFeome > snx12 – XORFeome 2.0

snx12 – XORFeome 2.0

General Information

Species: Xenopus tropicalis sorting nexin 12, mRNA (cDNA clone MGC:75986 IMAGE:5384361), complete cds
Gene Symbol: snx12
Gene ID: 394626
ORF gb_acc: MG133465
ORF ID: 10986

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061400

Library Location

Plate ID: GDExt11009
Well Location: E10

EST Sequences

Clone: MGC:75986 IMAGE:5384361
Trimmed Sequence: ATGGCGGATACAGTTGCGGACACTCGCCGGCTGTTGAGCAAACCACAGAATCTAAATGATGCCTACGGACCCCCTAGCAACTTCCTTGAGATTGATGTGAGCAACCCGCAGACTATCGGGGTTGGCAGGGGCAGGTACACTACTTATGAGGTCCGCCTGAAGACAAATCTTCCAATTTTTAAGCTGAAGGAGTCTTGTGTTAGAAGACGATACAGTGATTTTGAATGGCTAAAAAGTGAGCTTGAAAGAGAAAGCAAGGTGGTAGTACCTCCTTTACCCGGAAAAGCTTTCTTTCGGCAACTTCCATTTAGAGGAGATGAAGGAATATATGATGACTCTTTCATAGAGGAAAGGAAGCAAGGCCTCGAACAATTTATAAACAAAGTTGCGGGACATCCATTGGCGCAGAATGAACGGTGCCTTCATATGTTTTTACAAGATGAAATATTAGACAAGAACTACACCCCATCCAAAATAAGACATGCCTAA
Full Trace Sequence: cctgactcctgctttctgctgccgccacttccggcacccactcgcatagtgtggaaaagtcgcctggatttagggacccgattctactctttcctactctccatctcttaatcccggtaacatggcggatacagttgcggacactcgccggctgttgagcaaaccacagaatctaaatgatgcctacggaccccctagcaacttccttgagattgatgtgagcaacccgcagactatcggggttggcaggggcaggtacactacttatgaggtccgcctgaagacaaatcttccaatttttaagctgaaggagtcttgtgttagaagacgatacagtgattttgaatggctaaaaagtgagcttgaaagagaaagcaaggtggtagtacctcctttacccggaaaagctttctttcggcaacttccatttagaggagatgaaggaatatatgatgactctttcatagaggaaaggaagcaaggcctcgaacaatttataaacaaagttgcgggacatccattggcgcagaatgaacggtgccttcatatgtttttacaagatgaaatattagacaagaactacaccccatccaaaataagacatgcctaagaactggaaaatgaactgaaatactatgacattaaaaccttataaatttactgtcatcggcatgttacaatctgctattatgaatgtaacatactaatcgccatcttctttctttaagtgttgttctacaaactggttcatttgcagatattgtgactgcttggttgcctgtactggactgtagttagtcttgttttacacattgaaaaccatatgtgttgttgatattttttacaatggccgtatacaaaactaagataatgattgtcatagcattttgaaaagtatagaaattctgtcaggaagcagacaaaaggggttattttaccctgtctatttaagggattctgtcatgattttatggtgtagtttcttattactagattacactgtttacatagcaaattattcactctaccatatacaatggtattcttgaaccaccaaatgtgtttttagctgtaatattggtgtgtaggcagtcatctcagtgcattatgcccgagtctgagcttttagaaagagccagcacttcacaatgcaactgctttcagttaagctgtttctcctacttagtgtaactgaccagaccaatggccattttactattgagtgctattgtcatatttaccactggatggggaatgggaacatttaatttttgcaatataggtgtcgggaagctgatatcttgttacctttccattgctctaaaaaaagactgctaggagggaaaggaaagggggtgaaatcattccagcttgtgtgtgtgtgtgtatatatctgtatctcctttactgtccgagctaattgaggccaatggcacatgggacagtttccacagtgtagtttagctggcagaaaaatgcacaagtcacatggctgagggcacctggaaaactaagaatatgtctagcccccacatcagattataaaaataaatgtaaaaaaacgttcttttgaaaactggatttcaatacaggattctgctggaggagcactattaactgatacattttgtaaaaataacatgttttcctgtgacagaatccctttaaaggagtattttacagttttaggcagtgtcccatttgacttgcttcctttcattttttctttttttaaatcatattttgcattagttaatgattggggccttttacaaagcaatggttatataataagtctgtccctgctgtttttcaatggcatatttagaaagatgtgtaaaattttatgccaaaaaaactgtgtaaatggcccatgtgtaaagatctgtattttgcagttatcgataaaataatgccatatatcacaatcatgtaaataatctattacacagagcaagtctgcatatttataagtgtgtgtattttactattctaaagcctaaaatgactccattgttttacaccactctacacatggcacaatgggacaatacaggattcaaagtatttctgaagtaaacagtgtagattggtgtgtaatacgttttaacactatgcactggttttaatgtggctttttccaaagtaatgcttattttacattagatttttacctttgactgggcatttgcatatcatcaccatgcagcttaataaatgtttaaaaaaaaaaaaaaaaaaaaaa
Translation: MADTVADTRRLLSKPQNLNDAYGPPSNFLEIDVSNPQTIGVGRGRYTTYEVRLKTNLPIFKLKESCVRRRYSDFEWLKSELERESKVVVPPLPGKAFFRQLPFRGDEGIYDDSFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEILDKNYTPSKIRHA
Donor tissue: neurula