ORFeome > sox3 – XORFeome 2.0

sox3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis SRY (sex determining region Y)-box 3, mRNA (cDNA clone MGC:79596 IMAGE:6979162), complete cds
Gene Symbol: sox3
Gene ID: 493228
ORF gb_acc: MG133637
ORF ID: 11184

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC079938

Library Location

Plate ID: GDExt11012
Well Location: B03

EST Sequences

Clone: MGC:79596 IMAGE:6979162
Trimmed Sequence: ATGTATAGCATGTTGGACACAGACCTCAAGAGCCCGGTGCAGCAGAGCAATGCACCGAACGGGGGCCCCGGCACCCCAGGGGGCAAAGGCAATGCTTCTATCCCGGATCAGGAGCGGGTGAAACGGCCGATGAACGCGTTTATGGTGTGGTCCCGGGGCCAGCGGAGAAAGATGGCCCAGGAGAACCCCAAGATGCACAACTCGGAGATCAGTAAGAGGCTGGGGGCTGACTGGAAGTTGTTGAGCGATTCCGAGAAAAGACCCTTCATCGACGAGGCCAAGAGGCTGAGAGCAGTCCATATGAAGGAGTACCCGGATTACAAGTACAGACCCCGCAGGAAGACCAAGACCCTCCTGAAAAAGGACAAGTATTCCCTGCCTGGCAACCTTTTGGCTCCAGGAGTTAGCCCGGTGGCCAGCAGTGTTGGTGTTGGCCAGAGGATAGACACTTATGCTCACATGAATGGCTGGACTAATGGGGCTTATTCCCTGATGCAGGACCAGCTGGGCTACAGCCAGCACCCTGGGATGAACAGCCCCCAGATGCAGCAGATCCAGCACAGGTATGACATGGGCGGCCTGCAGTACAGCCCAATGATGTCCTCCGCGCAAACTTACATGAATGCTGCTGCCTCTACCTATAGCATGTCCCCTGCCTACAACCAGCAGAGCTCCACGGTCATGAGTTTGGGCTCTATGGGCTCAGTGGTGAAATCCGAACCCAGCTCCCCCCCTCCAGCCATCACCTCCCACACGCAAAGGGCCTGCCTGGGAGACCTGCGAGATATGATCAGCATGTACCTGCCCCCAGGTGGAGATGCCAGCGACCCTTCTTCCCTTCAGAGTAGCAGACTGCACAGTGTACACCAACATTACCAGAGCGCAGCTGGCCCCAATGGCACTGTACCGCTCACTCACATATAA
Full Trace Sequence: gcaggagttagggaagtttgtgccgggatctgtgtggcagagcagcttcattttctcccgtgcagtgtctcctccacctgcagctccagatgtatagcatgttggacacagacctcaagagcccggtgcagcagagcaatgcaccgaacgggggccccggcaccccagggggcaaaggcaatgcttctatcccggatcaggagcgggtgaaacggccgatgaacgcgtttatggtgtggtcccggggccagcggagaaagatggcccaggagaaccccaagatgcacaactcggagatcagtaagaggctgggggctgactggaagttgttgagcgattccgagaaaagacccttcatcgacgaggccaagaggctgagagcagtccatatgaaggagtacccggattacaagtacagaccccgcaggaagaccaagaccctcctgaaaaaggacaagtattccctgcctggcaaccttttggctccaggagttagcccggtggccagcagtgttggtgttggccagaggatagacacttatgctcacatgaatggctggactaatggggcttattccctgatgcaggaccagctgggctacagccagcaccctgggatgaacagcccccagatgcagcagatccagcacaggtatgacatgggcggcctgcagtacagcccaatgatgtcctccgcgcaaacttacatgaatgctgctgcctctacctatagcatgtcccctgcctacaaccagcagagctccacggtcatgagtttgggctctatgggctcagtggtgaaatccgaacccagctccccccctccagccatcacctcccacacgcaaagggcctgcctgggagacctgcgagatatgatcagcatgtacctgcccccaggtggagatgccagcgacccttcttcccttcagagtagcagactgcacagtgtacaccaacattaccagagcgcagctggccccaatggcactgtaccgctcactcacatataacacttttgcttctgctcttttctaaagacgctttgcttgcctggcaagtatcagactgaattaaaaaaagacccacttgaggacaatgaatcaagggtgtattttgtacaaaagtttgcgcaaacttcctttatagagcacaatattttatgtactttttgttgggggggggattatgtgttggggcttttaaaatccagaggttccaggtgttctttatcccatttacacgtacctggtaccttcagttgtacaagtcgggacgatcttaaccataacatgtttacacgttttaatgacacgctcaagatttccttgggttttatccaaaactgtagattttatcgtttgcatatttttttttttttagacttgacttttcaaaagagctgtgcgggtcgcaaacaggacttttattttgttttcttttaatttatagtatgtatttttttttttttcctccatgtgaaatcgcctttttttctggctcatatttactgtgaattgtttaacatatcaacaacaaatactttagaattgttttactgggtttctaaagactttgacatgaaagtaaaacgacatactcaataaattttctatgaggaatgtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MYSMLDTDLKSPVQQSNAPNGGPGTPGGKGNASIPDQERVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGADWKLLSDSEKRPFIDEAKRLRAVHMKEYPDYKYRPRRKTKTLLKKDKYSLPGNLLAPGVSPVASSVGVGQRIDTYAHMNGWTNGAYSLMQDQLGYSQHPGMNSPQMQQIQHRYDMGGLQYSPMMSSAQTYMNAAASTYSMSPAYNQQSSTVMSLGSMGSVVKSEPSSPPPAITSHTQRACLGDLRDMISMYLPPGGDASDPSSLQSSRLHSVHQHYQSAAGPNGTVPLTHI
Donor tissue: tailbud