ORFeome > spo11 – XORFeome 2.0

spo11 – XORFeome 2.0

General Information

Species: Xenopus tropicalis spo11 protein, mRNA (cDNA clone MGC:79678 IMAGE:6980640), complete cds
Gene Symbol: spo11
Gene ID: 493562
ORF gb_acc: MG133740
ORF ID: 11308

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080352

Library Location

Plate ID: GDExt11012
Well Location: C07

EST Sequences

Clone: MGC:79678 IMAGE:6980640
Trimmed Sequence: ATGGACCTATTGCTGAGCCCAGACTTTTTTCAGTATGTGGAACGACACCGGGCATCTCTGCTGAAGAAGCTGCAGGAAAATGTGGAGCAAAGCTCTAGTTGGCAAGGGGAAACACAAGAGAACATAACCAGTTCCCAGGTTCTTGCTGCCATTGAACGTATAATCCAGGGAATAACGGAAAGCCTGTCTAAAAATGAAGCGCCTGTTCTCACCCTGGACAACAGAACAAACTGGGCAAACATAGAGTTTAACCATTTAGTTGGGCTGCAGATAGCAAAACATTGCACTACCAGGAAAGTAAGGAGCAACTGTGCCAAGTCTGCGCAGAAGTTTGCCCTGATGCTTAAGGTACTGTCAGTGATCTACAAACTGGTCCAGACTGATACGTACACTACAAAAAGAGATATATATTACAATGATGTGCAACTTTATGGCTCCCAGACAGTGGTGGACAACATTGTTAGCGATCTCTCCTGCATGCTGAAAATCCCAAGAATCAATTTACACATACTCTCTACGTCCAAGGGGTGTGTGGCTGGAGATTTATGGTTTACGGCCGAAGATGGAAGCAAAGTGTACTGCGGTGGCAGCTCATCGGGCGTCCTCGTGCCAATAAATGTCGAAGGAATCAGACACCTGAGTACCCAGGCTAAATTCATCCTCATAATCGAAAAGGATGCAACGTTCCAAAGGCTTCTGGATGACAACTTCTGTGCTAGGTCTGGCCCCTGCATCTTGATTACAGGAAAAGGTGTCCCGGATCTGAACACCAGGCTTCTCACCCGGAAACTGTGGGATTCCTTCCACATCCCCATCTTCACCCTGGTTGACGCCGACCCCTATGGTACAAAGTTAGGAGACAACGTTCAGAAGCAGAGTTCGATTCTTCCCATAACATTGTTTCCGTATATATTTTCTTTCACATTCTCTTGTTTGTGTTTCAGGGATAGAAATCATGTGCATTTACAAGTATGGATCTATATCCATGTCATACGAAGCTCATCACTTGACTGTCCCTGCAATTGCATGGCTTGGCCTCCTACCATCAGATTTAGAGAGGTTATTCATTCCCAAAGATGTTCTGATACCACTAAGTCCACTGGACCGGAGGAAGCTGCTTAG
Full Trace Sequence: taacttttttgggaggtagaggaacatcagtgactgccgtacaaggggttttccgagatttcaacgttaaggactaaagaatattaataggccaaaaactgggcttattaaggacagaaatggacctattgctgagcccagacttttttcagtatgtggaacgacaccgggcatctctgctgaagaagctgcaggaaaatgtggagcaaagctctagttggcaaggggaaacacaagagaacataaccagttcccaggttcttgctgccattgaacgtataatccagggaataacggaaagcctgtctaaaaatgaagcgcctgttctcaccctggacaacagaacaaactgggcaaacatagagtttaaccatttagttgggctgcagatagcaaaacattgcactaccaggaaagtaaggagcaactgtgccaagtctgcgcagaagtttgccctgatgcttaaggtactgtcagtgatctacaaactggtccagactgatacgtacactacaaaaagagatatatattacaatgatgtgcaactttatggctcccagacagtggtggacaacattgttagcgatctctcctgcatgctgaaaatcccaagaatcaatttacacatactctctacgtccaaggggtgtgtggctggagatttatggtttacggccgaagatggaagcaaagtgtactgcggtggcagctcatcgggcgtcctcgtgccaataaatgtcgaaggaatcagacacctgagtacccaggctaaattcatcctcataatcgaaaaggatgcaacgttccaaaggcttctggatgacaacttctgtgctaggtctggcccctgcatcttgattacaggaaaaggtgtcccggatctgaacaccaggcttctcacccggaaactgtgggattccttccacatccccatcttcaccctggttgacgccgacccctatggtacaaagttaggagacaacgttcagaagcagagttcgattcttcccataacattgtttccgtatatattttctttcacattctcttgtttgtgtttcagggatagaaatcatgtgcatttacaagtatggatctatatccatgtcatacgaagctcatcacttgactgtccctgcaattgcatggcttggcctcctaccatcagatttagagaggttattcattcccaaagatgttctgataccactaagtccactggaccggaggaagctgcttagcatccagaagagaccctacattgcctgccagccgctctggaaacgagaaattgagaaaatggcagccagcgaaaggaaggcagaaatccaagccctgacgtcactgtctcctgacttcctgtccagggtctatttacccaacaagctgcgttacggaggctggatctgagcagcgcaggacacgtattggggctaaaaaactgcatgttttttcttaatgcaaaattgttatttttcagttggaatattaagcatttcttgttaccttgttactagtttggcaaaataaaaaagttatgagcacaaaaataaaaaaaaaaaaaaaaa
Translation: MDLLLSPDFFQYVERHRASLLKKLQENVEQSSSWQGETQENITSSQVLAAIERIIQGITESLSKNEAPVLTLDNRTNWANIEFNHLVGLQIAKHCTTRKVRSNCAKSAQKFALMLKVLSVIYKLVQTDTYTTKRDIYYNDVQLYGSQTVVDNIVSDLSCMLKIPRINLHILSTSKGCVAGDLWFTAEDGSKVYCGGSSSGVLVPINVEGIRHLSTQAKFILIIEKDATFQRLLDDNFCARSGPCILITGKGVPDLNTRLLTRKLWDSFHIPIFTLVDADPYGTKLGDNVQKQSSILPITLFPYIFSFTFSCLCFRDRNHVHLQVWIYIHVIRSSSLDCPCNCMAWPPTIRFREVIHSQRCSDTTKSTGPEEAA
Donor tissue: tailbud