ORFeome > spop – XORFeome 2.0

spop – XORFeome 2.0

General Information

Species: Xenopus tropicalis speckle-type POZ protein, mRNA (cDNA clone MGC:75799 IMAGE:5382242), complete cds
Gene Symbol: spop
Gene ID: 394599
ORF gb_acc: MG132941
ORF ID: 10311

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061316

Library Location

Plate ID: GDExt11003
Well Location: C08

EST Sequences

Clone: MGC:75799 IMAGE:5382242
Trimmed Sequence: ATGTCGCGAGTACCCAGTCCCCCTCCCCCGGCTGAGATGTCCAGTGGCCCTGTGGCAGAAAGCTGGTGCTATACTCAGATTAAAGTTGTCAAGTTTTCCTACATGTGGACCATCAACAACTTTAGCTTTTGCCGAGAGGAGATGGGGGAGGTGATCAAGAGCTCAACCTTCTCTTCGGGCGCCAATGACAAACTCAAATGGTGCTTGCGTGTTAACCCCAAGGGACTGGATGAGGAGAGTAAAGATTATCTATCCCTCTACCTACTGTTGGTTAGTTGTCCAAAGAGTGAAGTGCGCGCCAAGTTTAAATTCTCCATTCTAAATGCCAAGGGAGAGGAAACCAAAGCAATGGAGAGTCAGCGTGCCTACCGGTTCGTTCAGGGGAAGGACTGGGGCTTCAAGAAATTTATCCGCAGGGACTTTTTACTTGATGAGGCCAATGGCCTGCTTCCGGATGACAAACTAACTCTGTTTTGTGAGGTTAGTGTGGTGCAGGACTCTGTCAACATTTCTGGCCAGAACACAATGAACATGGTCAAAGTCCCAGAATGCCGCCTTGCAGATGAACTTGGAGGACTGTGGGAGAACTCTCGTTTCACGGACTGCTGTCTGTGTGTGGCTGGCCAAGAATTCCAGGCACACAAAGCCATCCTGGCAGCACGGTCTCCTGTGTTTAGCGCAATGTTTGAGCATGAAATGGAAGAGAGTAAAAAGAATCGTGTGGAGATAAAAGACGTGGAACCGGACGTGTTTAAAGAAATGATGTGTTTCATCTACACGGGGAAAGCCTCCAACCTTGACAAAATGGCTGATGATTTATTGGCTGCAGCAGACAAGTATGCTCTAGAACGCCTCAAAGTGATGTGCGAGGAAGCGCTTTGCAGTAACCTGTCAGTAGAAAATGCAGCAGAAATCCTGATCTTGGCTGACTTACACAGTGCAGATCAGCTGAAAACGCAGGCTGTGGACTTCATCAATTACCATGCCTCTGATGTCATGGAAACCTCTGGATGGAAGTCTATGGTGGTCTCTCACCCACACCTGGTAGCAGAAGCATACCGCTCGCTAGCATCCGCCCAGTGCCCCTTTCTGGGCCCTCCACGCAAACGCCTGAAGCAATCCTAA
Full Trace Sequence: cggtgacgtcacggagggttcgcgtacttcccagctgtatgcagagagtcggaccgtatctgtgaggcacagatactattggaattataattcgggatcgcagtatgtcttaactcacgtctgttctgtaaggttggaagaaaacagacaccggtggggaaacatccacccatcattctctaactgcttctatcatcactgctctgataccctagtgacaggagaaggtcccttgggttccttactccaatcctaaggagttatcaagctggcgatgtcgcgagtacccagtccccctcccccggctgagatgtccagtggccctgtggcagaaagctggtgctatactcagattaaagttgtcaagttttcctacatgtggaccatcaacaactttagcttttgccgagaggagatgggggaggtgatcaagagctcaaccttctcttcgggcgccaatgacaaactcaaatggtgcttgcgtgttaaccccaagggactggatgaggagagtaaagattatctatccctctacctactgttggttagttgtccaaagagtgaagtgcgcgccaagtttaaattctccattctaaatgccaagggagaggaaaccaaagcaatggagagtcagcgtgcctaccggttcgttcaggggaaggactggggcttcaagaaatttatccgcagggactttttacttgatgaggccaatggcctgcttccggatgacaaactaactctgttttgtgaggttagtgtggtgcaggactctgtcaacatttctggccagaacacaatgaacatggtcaaagtcccagaatgccgccttgcagatgaacttggaggactgtgggagaactctcgtttcacggactgctgtctgtgtgtggctggccaagaattccaggcacacaaagccatcctggcagcacggtctcctgtgtttagcgcaatgtttgagcatgaaatggaagagagtaaaaagaatcgtgtggagataaaagacgtggaaccggacgtgtttaaagaaatgatgtgtttcatctacacggggaaagcctccaaccttgacaaaatggctgatgatttattggctgcagcagacaagtatgctctagaacgcctcaaagtgatgtgcgaggaagcgctttgcagtaacctgtcagtagaaaatgcagcagaaatcctgatcttggctgacttacacagtgcagatcagctgaaaacgcaggctgtggacttcatcaattaccatgcctctgatgtcatggaaacctctggatggaagtctatggtggtctctcacccacacctggtagcagaagcataccgctcgctagcatccgcccagtgcccctttctgggccctccacgcaaacgcctgaagcaatcctaaagctgcttagtggatagcccaacgtttctcctggagccactctacttttcctcaaagcatgagagacattggtgggggagactgattggaggttcctgtctttacctcctccacattgtgtgatttgccaccctactccccatgccgcgttggctggactgagcctcctctctcccatatttctgagtgaggagcaggggccatagtggatgtgccctgaactgcggaacaaaattttatattttatggatggccggtgtgtttaagactgggactttcctgttatttatagggacagaaagcagctttaattagccagttgcattttttctgtcccaaaggacattggagtagagaaatttaagggctgagcaatttccgcagctctcctcatcttcccccccgcccccaaaaaggacagagttggaggcgggcacagtttataccatttactctgggatgttttacttttttttgatatgcctccttcaaagtttgttgttaatccttccacgttcttttacttctcctgtccatcttgccttttagttcttacagatatccctaagcctaaaggtccttcactgatgcttcaaagccgttagatttattttgattttcgagaatataataattcctattttgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEIKDVEPDVFKEMMCFIYTGKASNLDKMADDLLAAADKYALERLKVMCEEALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVMETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS
Donor tissue: neurula