ORFeome > spred1 – XORFeome 2.0

spred1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis sprouty-related, EVH1 domain containing 1, mRNA (cDNA clone MGC:79569 IMAGE:6978755), complete cds
Gene Symbol: spred1
Gene ID: 493399
ORF gb_acc: MG133643
ORF ID: 11192

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080919

Library Location

Plate ID: GDExt11011
Well Location: C11

EST Sequences

Clone: MGC:79569 IMAGE:6978755
Trimmed Sequence: ATGAGCGGCGAACAGGAGCCAGATGACAGTTATGCACGAGTGCGAGCTGTGGTGATGACAAGGGATGACTCGAGTGGTGGTTGGCTACAACTTGGAGGTGGAGGGCTCAGCTCTGTTACTGTGTCTAAGACTCTTCAACCAGGAGACAGTGGTGGCACAGAATTCCTAGTTCATGGCGAGAGACTCAGAGATAAGACGGTGGTCCTGGAATGTGTGCTCAGGAGGGATCTTGTCTACAATAAAGTTACCCCTACATTCCATCACTGGAGGATCGGAGACAAGAAGTTCGGCCTTACGTTCCAAAGTCCCGCCGATGCCCGAGCTTTTGATAGAGGAATACGTCGTGCCATTGAAGACCTGTCTCAAGGCTTACCAGCATCTTGCCATGGAGAGTCAGAAACTTCTGAGGATGGACCACAGGTGAATAAAGAAGACCATTACAGCACTCATAACAACGATCACTTTTTCCGAAGCGACTCTATACCAACTGAAGAACTGTATCGCACCTCTGTCATTAGACCCTCCCCATTTGAAAATCTGAACCCAAGGAGAGCCTACATCCATAACCAGGTTCCTCTCAAGCCAATTCGACATGTCAGCTTCCAGGATGAAGATGAGATAGTTCGCATTAACCCCCGTGACATGATTATTCGCCGCTATGCAGATTACCGGCACCCAGACATCTTTCGGAATGACGTTGATCGGGAGGAACCAGAAGATGTTACATTCTTTACCAAGACGGACAGTAAAAAGCCCAGCTATCTCTACTCCCCAGCCAATGGCAGAGACTCTCTCAAGGAGCAAAAACCAGTGGAGGTTTGCAAGATTCAGCCAACATCCTCTCTTAAAAAGTCCAAAGGGAAAAAAGAGGATGGAGAACATTCAAGCTGTGTATACTGCCAGGAGCGATTTAACCACGAGGAGAATGGAAGGGGGAAGTGCCAGGATGCACCAGATCCCATCCAGAGGTGCATCTACCAGGTCAGCTGTATGCTGTGCGCCGAGAGCATGCTCTACCACTGCATGTCAGACTCTGAAGGAGATTATTCCGACCCGTGCTCTTGTGACGCCTCTGATGAAAACCTGTGCCTGCGCTGGCTGGCTCTAATCACGTTATCCTTCATAGCCCCTTGTATGTGCTGCTACCTCCCGCTGCGCGCTTGTCACCATTGTGGTGAGATGTGTGGTTGCTGCGGTGGGAAGCATAAAGCAGCTGGATGA
Full Trace Sequence: cggggcgcacttcccatataaccttccgattgcctcccggatccctgtgccctcaccatgcgtctccttcgggagcctccctgcgccctggccgacggcagccagccccgaatcggagcccggtgaaaggggacaatgagcggcgaacaggagccagatgacagttatgcacgagtgcgagctgtggtgatgacaagggatgactcgagtggtggttggctacaacttggaggtggagggctcagctctgttactgtgtctaagactcttcaaccaggagacagtggtggcacagaattcctagttcatggcgagagactcagagataagacggtggtcctggaatgtgtgctcaggagggatcttgtctacaataaagttacccctacattccatcactggaggatcggagacaagaagttcggccttacgttccaaagtcccgccgatgcccgagcttttgatagaggaatacgtcgtgccattgaagacctgtctcaaggcttaccagcatcttgccatggagagtcagaaacttctgaggatggaccacaggtgaataaagaagaccattacagcactcataacaacgatcactttttccgaagcgactctataccaactgaagaactgtatcgcacctctgtcattagaccctccccatttgaaaatctgaacccaaggagagcctacatccataaccaggttcctctcaagccaattcgacatgtcagcttccaggatgaagatgagatagttcgcattaacccccgtgacatgattattcgccgctatgcagattaccggcacccagacatctttcggaatgacgttgatcgggaggaaccagaagatgttacattctttaccaagacggacagtaaaaagcccagctatctctactccccagccaatggcagagactctctcaaggagcaaaaaccagtggaggtttgcaagattcagccaacatcctctcttaaaaagtccaaagggaaaaaagaggatggagaacattcaagctgtgtatactgccaggagcgatttaaccacgaggagaatggaagggggaagtgccaggatgcaccagatcccatccagaggtgcatctaccaggtcagctgtatgctgtgcgccgagagcatgctctaccactgcatgtcagactctgaaggagattattccgacccgtgctcttgtgacgcctctgatgaaaacctgtgcctgcgctggctggctctaatcacgttatccttcatagccccttgtatgtgctgctacctcccgctgcgcgcttgtcaccattgtggtgagatgtgtggttgctgcggtgggaagcataaagcagctggatgacacggtaactcttatcctgcaatgccaggaggaattcctacatttcccaggtggctgctggtcctgacgtcggcagttttaggtggagctgtaactggctcgtgggaagaggactaaatggtgctgtctaggttcagataggaccagcaagaatatgtaacggtgccagtcttgcgatagatatatatatatatatatattatttttttctttttgtaattaatattattttattttttatttgccattcctgttcaaaagcagagaatttgtttttttcagattggccgccttgtagcgggataatgaactgtgaggaattccacaaggcaggatgatacaatgaatggatctctatccattaggctgtaggcttaaggaagtgagaaaatgattatagaacaatatatatatatatattttccgtattacatctcctctccagaaagcagtttaatatgagaaatctgttgattctggggggatgactaacattgtatacaaaagaaatgtgacgtggaggaaacggacaagcaacagacacgtggttacctaaaatgagtttttagtggaactaaatcatttctagttttattcaagtgattttatgtataaataacaaatgtctatatttaactaaatatacggtacgcagaattttatgacttttgggagggtgtttcttatgctccttattcagcttccaccactgttttcctaatgaaaattggcacattccattatagggctgagtcctgctgctatagaggggcaatctttctggcagcagaatggttaaaaagctgtttttttccagtgtattgtttttcagaagatttactgttaatccggattttctgtctctcggatctacctgtgttatgtcacattatttatacactctggtacatagaatataacacaactgtcagatatgtctgtgtctgtctttatttttatgcattgtataacaaggcaaaaaacaattggatccagttatccaaagccagatcttttaattagctgaggatgatgggatgatgggggtttcacagcagctgtaaagaaaatggtttcctttctctggacaaacaataaaatgatgggaatacaatggcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSGEQEPDDSYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTLQPGDSGGTEFLVHGERLRDKTVVLECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQGLPASCHGESETSEDGPQVNKEDHYSTHNNDHFFRSDSIPTEELYRTSVIRPSPFENLNPRRAYIHNQVPLKPIRHVSFQDEDEIVRINPRDMIIRRYADYRHPDIFRNDVDREEPEDVTFFTKTDSKKPSYLYSPANGRDSLKEQKPVEVCKIQPTSSLKKSKGKKEDGEHSSCVYCQERFNHEENGRGKCQDAPDPIQRCIYQVSCMLCAESMLYHCMSDSEGDYSDPCSCDASDENLCLRWLALITLSFIAPCMCCYLPLRACHHCGEMCGCCGGKHKAAG
Donor tissue: tailbud