ORFeome > sult2b1 – XORFeome 2.0

sult2b1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis sult2b1 protein, mRNA (cDNA clone MGC:79784 IMAGE:6985915), complete cds
Gene Symbol: sult2b1
Gene ID: 493303
ORF gb_acc: MG133762
ORF ID: 11331

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080367

Library Location

Plate ID: GDExt11013
Well Location: B05

EST Sequences

Clone: MGC:79784 IMAGE:6985915
Trimmed Sequence: ATGGGGGATTTTCAGGTTTCCCGGGACTACTTGACCTTTGAAGGAATGCGAGTGCCTTCCAATGTCCATACAGTGGAGAGCTTAACTTATGCTTGGAAAGAGTTTGTGACGCGCAACGATGATGTTTTTAATGTAACGTTCCCGAAATCAGGCACGACTTGGATGCAGGAAATCCTAACACTCATTTATAGCAATGGAGACCCTGCCCCAGTAAAGACAGAGTATAGTTGGGATCGTGTTCCCTGGCTAGAACAATATACCGGCCGAAGCAAATTGGAGAACAGACCGTCCCCTCGGCTCATCACAACGCATCTCCCTTTTCATTTATTTCCACAATCTTTCTTCAAGACAAAGGCCAAGGTTATCTACACCATACGAAATCCAAAAGATGTCTGCGTGTCTCTGTATTTCTTTTCCCTGATTGCTCAGTTCCTGGAATACAGGGAAGATTTCCAGGAGTTTGTCTCCTTATTTCTAAGTAAAGACATGTTCTATGATGGTTGGTTTGATCATGTGAAAGGTTGGCTGCCATTTAATGACAACCCCAATTTTCTTCTTTTGACATACGAAGATATGGCCAAAGATCTAAAAAGCAATGTGATTAAGATCTGTCAGTTTCTTGGAAAGGAGTTGGATGATGCCGCCATAAATTCTGTAGTGGAAAATTCCTCTTTCAAAGCAATGAAGGACAATGAGATGTCCAACTACAGTGCCGTGCCTGACTATATATTCAGCAAAGCCAAAGGGTCGTTCCACAGAAAAGTTTTCCTCCTGGACTTGTCTTTTTAG
Full Trace Sequence: gtcctgctgaactggctcacacagacgcgcttcttcagcattgtggcaactaacacttggagtgaaaatgggggattttcaggtttcccgggactacttgacctttgaaggaatgcgagtgccttccaatgtccatacagtggagagcttaacttatgcttggaaagagtttgtgacgcgcaacgatgatgtttttaatgtaacgttcccgaaatcaggcacgacttggatgcaggaaatcctaacactcatttatagcaatggagaccctgccccagtaaagacagagtatagttgggatcgtgttccctggctagaacaatataccggccgaagcaaattggagaacagaccgtcccctcggctcatcacaacgcatctcccttttcatttatttccacaatctttcttcaagacaaaggccaaggttatctacaccatacgaaatccaaaagatgtctgcgtgtctctgtatttcttttccctgattgctcagttcctggaatacagggaagatttccaggagtttgtctccttatttctaagtaaagacatgttctatgatggttggtttgatcatgtgaaaggttggctgccatttaatgacaaccccaattttcttcttttgacatacgaagatatggccaaagatctaaaaagcaatgtgattaagatctgtcagtttcttggaaaggagttggatgatgccgccataaattctgtagtggaaaattcctctttcaaagcaatgaaggacaatgagatgtccaactacagtgccgtgcctgactatatattcagcaaagccaaagggtcgttccacagaaaagttttcctcctggacttgtctttttaggtatcactggagactggaaaaactattttactccggaacgagaagaagaatttaataagatttaccaagacctcatgaaagacgtcaacctccagtttgcatagactgaattgcatccatgtatttgaatatttggaatagcgcaatatgtacatgtttctattatattttcatagctttttctactaggaacaatgtaatataataagttatggatgtaaaatgaaaattgaccttactttatgtgaatgtgagagggaatttagactgtaagctctgctggggcagggattgatgtgaatgatgtataatctctgtgaagtgctgtgtaaatatgttggcactatataaataaaggatggtaataaaataataaaggatatggtggaatctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MGDFQVSRDYLTFEGMRVPSNVHTVESLTYAWKEFVTRNDDVFNVTFPKSGTTWMQEILTLIYSNGDPAPVKTEYSWDRVPWLEQYTGRSKLENRPSPRLITTHLPFHLFPQSFFKTKAKVIYTIRNPKDVCVSLYFFSLIAQFLEYREDFQEFVSLFLSKDMFYDGWFDHVKGWLPFNDNPNFLLLTYEDMAKDLKSNVIKICQFLGKELDDAAINSVVENSSFKAMKDNEMSNYSAVPDYIFSKAKGSFHRKVFLLDLSF
Donor tissue: tadpole