ORFeome > sumo1 – XORFeome 2.0

sumo1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis SMT3 suppressor of mif two 3 homolog 1, mRNA (cDNA clone MGC:89967 IMAGE:7025844), complete cds
Gene Symbol: sumo1
Gene ID: 448691
ORF gb_acc: MG133108
ORF ID: 10537

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC077048

Library Location

Plate ID: GDExt11005
Well Location: C03

EST Sequences

Clone: MGC:89967 IMAGE:7025844
Trimmed Sequence: ATGTCTGATCAGGAAGCTAAACCATCTAGCGAGGATCTAGGAGACAAAAAAGAAGGAGGGGATTATATCAAACTCAAAGTCATCGGACAGGATAGCAGTGAAATTCACTTTAAGGTAAAGATGACAACGCATCTCAAAAAGCTGAAAGAGTCATACTGTCAGAGACAGGGTGTTCCAATGAATTCTCTCAGGTTTTTGTTTGAAGGGCAAAGAATCTCAGATCACCAGACTCCTAAGGAGCTCGGTATGGAGGAAGAGGATGTTATTGAAGTTTATCAGGAACAGACTGGGGGCCACTCGACAATTTAA
Full Trace Sequence: gacaccttccttgtctggttctcttgtgctgttattgtgcccggaggaaggaaaagcgtagagcggtccagtgtagcgaaccgataccggccgagagcagttagcatgtctgatcaggaagctaaaccatctagcgaggatctaggagacaaaaaagaaggaggggattatatcaaactcaaagtcatcggacaggatagcagtgaaattcactttaaggtaaagatgacaacgcatctcaaaaagctgaaagagtcatactgtcagagacagggtgttccaatgaattctctcaggtttttgtttgaagggcaaagaatctcagatcaccagactcctaaggagctcggtatggaggaagaggatgttattgaagtttatcaggaacagactgggggccactcgacaatttaaatttttccctcaccttcgttttttttttttttttaattattattttttttactttttttttttttttgtaatgtttacctctccttccccttggtactctgtttcctttcatgtaatcagccagatgtctgtggcatctagatcacctcattttaatatcttcatcagtatgagaagtcacttctgaagatgtcaccagtccaggctgttttagcttcactccttttggtctccaagaatattgatttgaatttacattgtaaaattactcggttgcttgggacacgaaaaagaacgttttttggggatttattgcacttcaaattgttgaataaaattttcaccattactgttatcgttccacctgcctagaagatataggagttgtgtttttagatacaagttgtcatgcaaccaccccctatgaaatgttcgctgtatcttttatttttgtggggcatgggttttaaaaaaaagtagaaaaaaaaaataaaaaaaaaaaaaaaa
Translation: MSDQEAKPSSEDLGDKKEGGDYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRISDHQTPKELGMEEEDVIEVYQEQTGGHSTI
Donor tissue: