ORFeome > sumo3 – XORFeome 2.0

sumo3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis SMT3 suppressor of mif two 3 homolog 3, mRNA (cDNA clone MGC:69539 IMAGE:5336640), complete cds
Gene Symbol: sumo3
Gene ID: 100125978
ORF gb_acc: MG133379
ORF ID: 10885

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074674

Library Location

Plate ID: GDExt11009
Well Location: H04

EST Sequences

Clone: MGC:69539 IMAGE:5336640
Trimmed Sequence: ATGTCTGAAGAGAAACCCAAGGAAGGTGTGAAGACAGAGAATGACCACATCAACCTGAAAGTGGCAGGGCAGGATGGATCTGTGGTTCAGTTCAAAATAAAAAGGCACACACCACTCAGCAAGTTAATGAAAGCTTACTGCGACAGACAGGGCCTATCAATGCGGCAGATAAGGTTCAGGTTTGATGGACAACCAATCAATGAAACAGACACACCTGCACAGCTGGAGATGGAAGATGAAGATACCATTGATGTGTTCCAACAACAGACAGGTGGTGTGTGCTAA
Full Trace Sequence: ggagagctagaaaagggcaatcatgtctgaagagaaacccaaggaaggtgtgaagacagagaatgaccacatcaacctgaaagtggcagggcaggatggatctgtggttcagttcaaaataaaaaggcacacaccactcagcaagttaatgaaagcttactgcgacagacagggcctatcaatgcggcagataaggttcaggtttgatggacaaccaatcaatgaaacagacacacctgcacagctggagatggaagatgaagataccattgatgtgttccaacaacagacaggtggtgtgtgctaagcactgaacaagttcaatctccagtatggcaggagctcaaattccctccatatgcctcatttctcacctatgccccttggatttgctgttaaatagttaacacagaacaaacatgctgatcacacgacacttctgaaaacgttggcggactctcccagggatgatattcaatcagaaatgcagttttcttttccagctgaacgtgccagaagttgtaaagtgggccaatctagagcattgtctttctctgctgaaagttttcaggcttttttgtgcagtactgtttgtttacagcagttctgtttagtttttccctctgtatcttcagatgtaaataattggatccttgcttgagtaatttttgagccagttccatgccagagtgtgtggttttgcatattctctgacatgcaaacagtaaatgcttgcccacacaggcaactgaaagatgtgaaaattaaggttgttataccagtaatggcagatgggagggaggggatatgcttttatttgctaaaatgtttcatttgaacattatctatcaaaaggatgtaagggttgtatatatagatatttgtatacccaggtactgaatctgaaaaaaaaaaacaaaaactttcaaaagagttaagactttgggtggctatgtttcactgctgaataggatttagagaatgaagcacaattctgctgactgcttggaccaacaggttttacccacttctcttatgcgagacaaaaatcatgccttctaatatactaatagcagcagaggttttaccattctgcaaatcaggctagatgcgtgagtgcaaaattttggcacttcaaaaattcagacgttttactacatttgtcaatggctcaccctgctttttatctgctgcacaggagcacttttttcagttccagattaaaaaaaataaataaataaaaactgacagcatgggctctttggtggtggtccattcaatgtcagaaatttttggtgttcccgactatagtgtgcgaattatgggtcccaaaaaacggttttaaaatctctacattccctttaagaatccttcttgaagttgtagtttatatatctgagcgtgctcttcctagcagtgttcagtagcaaaagatgttcaatactgcaagttagtagttttattccaacaatgttcttcaggttttccctttgtgctagttttacagtgccagccaaagatacatataaaaaaaattccctccctcaatctctaagattttgaattatgatgctcagttgtctatagtgtggtccctttttttttttaattgtactttctggataaatgtattctttcaacaaaataaagaaaagtcagaatttctgtttacttttgcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCDRQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVC
Donor tissue: tailbud