ORFeome > tardbp – XORFeome 2.0

tardbp – XORFeome 2.0

General Information

Species: Xenopus tropicalis TAR DNA-binding protein 43, mRNA (cDNA clone MGC:75857 IMAGE:5382813), complete cds
Gene Symbol: tardbp
Gene ID: 394651
ORF gb_acc: MG132989
ORF ID: 10371

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061336

Library Location

Plate ID: GDExt11004
Well Location: E06

EST Sequences

Clone: MGC:75857 IMAGE:5382813
Trimmed Sequence: ATGGAATACATAAGAGTGGCAGAGGATGAGAATGAAGAGCCAATGGAGATACCATCTGAAGATGATGGGACAGTACTGTTGTCTACAGTTACTGCCCAGTTTCCTGGTGCATGTGGTCTGAGATACAGAAACCCAGTGAATCAGTGTATGCGTGGTGTTCGATTGGTTGAAGGGATTCTCCATGCTCCTGAAAATGGCTGGGGAAACCTTGTTTATGTAGTCAATTATCCAAAAGATAACAAAAGGAAGATGGATGAAACTGATGCTTCTTCTGCAGTCAAAATAAAACGTGCAGTGACAAAAACATCAGATCTAATTGTGTTAGGTCTTCCGTGGAAAACCACAGAACAAGATTTGAAAGACTATTTCAGCACATTTGGTGAAGTGATTATGGTGCAGGTAAAGAAAGATGCTAAGACAGGTCATTCTAAAGGATTTGGATTTGTTAGATTTGCAGACTATGAGACACAAGTAAAAGTGATGTCTCAGCGTCATATGATTGATGGCCGTTGGTGTGACTGTAAGCTACCAAATTCTAAGAGTCCAGATGAACCTATGCGCAGCAGGAAGGTCTTTGTTGGGCGTTGCACAGAAGATATGAGTGCTGAGGAGCTTCGCCAGTTCTTCAGCCAGTATGGAGAAGTTGTGGATGTCTTTATTCCAAAGCCTTTCAGAGCATTTGCATTTGTTACATTTGCTGATGACCAGGTTGCACAATCTCTCTGTGGTGAAGACCTGATCATTAAAGGAGTCAGCGTTCATGTTTCTACTGCAGAGCCCAAGCACAATAACAATAGGCAATTAGAGAGAGGTGGCAGATTTCCTGGCCCAAGTTTTGGGAACCAGGGTTACCCCAACAGCCGGCCAAGTAGTGGTGCACTTGGCAACAACCAGGGTGGTAATATGGGTGGTGGTGGAGGGATGAATTTTGGGGCCTTTAGCATAAATCCAGCAATGATGGCAGCTGCCCAGGCAGCATTGCAAAGCAGCTGGGGTATGATGGGTATGCTCGCTAGTCAACAGAATCAATCTGGCCCCCAGGGAAGTAATCAGGGTCAAGGAAATCAACAAAGGGACCAGCCACAAAGTTTTGGTTCAAATAATTCTTATGGTTCCAACTCTGGTGCAATAGGTTGGGGGTCCCCTAATGCTGGATCTGGCAGTGGATTTAATGGCGGCTTTAGTTCAAGCATGGAATCAAAATCTTCAGGATGGGGAATGTAG
Full Trace Sequence: gtagaacgtgtgagtggttttagaagcagtagctggatcagcgtatgctcgtataccgtaattccgctagtcatttacacacaacatttgatttgcctcgtctagtaggggcagtctggttatttgaccgcaaaaacagtttgcagaaatggagatggaatacataagagtggcagaggatgagaatgaagagccaatggagataccatctgaagatgatgggacagtactgttgtctacagttactgcccagtttcctggtgcatgtggtctgagatacagaaacccagtgaatcagtgtatgcgtggtgttcgattggttgaagggattctccatgctcctgaaaatggctggggaaaccttgtttatgtagtcaattatccaaaagataacaaaaggaagatggatgaaactgatgcttcttctgcagtcaaaataaaacgtgcagtgacaaaaacatcagatctaattgtgttaggtcttccgtggaaaaccacagaacaagatttgaaagactatttcagcacatttggtgaagtgattatggtgcaggtaaagaaagatgctaagacaggtcattctaaaggatttggatttgttagatttgcagactatgagacacaagtaaaagtgatgtctcagcgtcatatgattgatggccgttggtgtgactgtaagctaccaaattctaagagtccagatgaacctatgcgcagcaggaaggtctttgttgggcgttgcacagaagatatgagtgctgaggagcttcgccagttcttcagccagtatggagaagttgtggatgtctttattccaaagcctttcagagcatttgcatttgttacatttgctgatgaccaggttgcacaatctctctgtggtgaagacctgatcattaaaggagtcagcgttcatgtttctactgcagagcccaagcacaataacaataggcaattagagagaggtggcagatttcctggcccaagttttgggaaccagggttaccccaacagccggccaagtagtggtgcacttggcaacaaccagggtggtaatatgggtggtggtggagggatgaattttggggcctttagcataaatccagcaatgatggcagctgcccaggcagcattgcaaagcagctggggtatgatgggtatgctcgctagtcaacagaatcaatctggcccccagggaagtaatcagggtcaaggaaatcaacaaagggaccagccacaaagttttggttcaaataattcttatggttccaactctggtgcaataggttgggggtcccctaatgctggatctggcagtggatttaatggcggctttagttcaagcatggaatcaaaatcttcaggatggggaatgtagtcttattagaagacactgggtttctggtgggtaattcataatttttatggtaagtatattgcagaatgtttccaaaaggtttttgagtatgttcagtagtaaacttaagggaactgttttctaagtttgtacttcagtttaacaatctggtctcaatactactttctgactgaacatgcatgttatagaccactggttaacaacctgtagtaattccagccttttttctttgcctcagtctgtatattaatgtaaatggaatcatgcatttttgtttaggacagtcttcctaccttaattgtgttcactgcttcaactgatctctgctccttaccatgcctttctggaacctgctactgaatgcagttgattccctgccctggagcacttttgcctacaagctttttcctagcctgaagattcatgctgcgtgatgagtcttaagacggtgggtgatccatttttatccagtttgtttcatggaattcgtaccagcaatttgaacgcacggctgtgaggtggaaccagaaggctgtttgaactgtgggattggtgtttccaaagaatgagagtctttggtatgagcgagaacaagagcgtatgcagagaccagtggtgcattatggattactaagttgtcagtgtctctcaatccagtggcaattatgagcgtgtgcagagagcagtgggagcaagtaacgtacgaatgtttcctgcattcgaaggactttagctcatttgaaagactggggctaaaccaatttgcctgaaacagtttgtacattttcaccctacccttcttaaaatgtctactgctgtgaatgctgtatgatgtgtgcattttctttgttattgaaatgtgagtcaatgtgatgaactgcatctctgtcagagtggcttgaaatatgcttctcaagagtgtaggggggtgtcttggtctgtaagtaacaacaagaatgctgtttgctgcagttgtgttatgtttggatgctttttacaagacttgtcattgtaggttattaaataaaactttaaataagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MEYIRVAEDENEEPMEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVNQCMRGVRLVEGILHAPENGWGNLVYVVNYPKDNKRKMDETDASSAVKIKRAVTKTSDLIVLGLPWKTTEQDLKDYFSTFGEVIMVQVKKDAKTGHSKGFGFVRFADYETQVKVMSQRHMIDGRWCDCKLPNSKSPDEPMRSRKVFVGRCTEDMSAEELRQFFSQYGEVVDVFIPKPFRAFAFVTFADDQVAQSLCGEDLIIKGVSVHVSTAEPKHNNNRQLERGGRFPGPSFGNQGYPNSRPSSGALGNNQGGNMGGGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPQGSNQGQGNQQRDQPQSFGSNNSYGSNSGAIGWGSPNAGSGSGFNGGFSSSMESKSSGWGM
Donor tissue: neurula