ORFeome > tmed10 – XORFeome 2.0

tmed10 – XORFeome 2.0

General Information

Species: Xenopus tropicalis transmembrane emp24-like trafficking protein 10, mRNA (cDNA clone MGC:79820 IMAGE:6986884), complete cds
Gene Symbol: tmed10
Gene ID: 493305
ORF gb_acc: MG133774
ORF ID: 11345

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC080371

Library Location

Plate ID: GDExt11013
Well Location: C07

EST Sequences

Clone: MGC:79820 IMAGE:6986884
Trimmed Sequence: ATGATATGGCCCCTGCTTCTTCTTGTACCCTGTTTCTTGTTGCCCGGGACCGGGGCGATCTCCTTCTACTTGCGTCCTCTGGGGAAAAAGTGCCTGAAAGAAGAAATTCATAAAGATGTGTTGGTGACTGGAGAGTATGAGGTGTCTGAGCAGCCTGGTCTGACTTGCGACCTCAAGGTAACAGACTCCATTGGCCACATTCTTTATTCCAAGGAAGATGCAAGGAAGGGCAAATTTGCATTTACTACTGATGATAATGATGTGTATGAAGTCTGCTTTGTGAGCAAAAGTCCATCTGATACGCTCAGTTTCACAGACCAATTAATTGCCCTTGATATAAAGCATGGCGTGGAAGCAAAGAATTATAAAGATGTTGCAGAGACAGAGAAATTGAAGCCACTTGAAGTTGAGCTTAGACGTTTAGAGGATTTAACACAATCGGTTGTGAAGGACTTTTCTTATATGAAGAAAAGAGAAGAAGAAATGAGGGACACTAATGAATCGACCAGTCTCCGTGTACTCTACTTTAGTGCGTTCTCCATGTTTTGTCTTGTGGCCCTTGCTACGTGGCAAGTCTTTTACTTGAGACATTTCTTCAAGGCAAAGAAACTTATTGAGTGA
Full Trace Sequence: cgtgtgcggaagtgaggcttgggacgcttatcttacacgacaagggaagtgaaattgattgctccctcctggcaatccaaagttagctgctgcatctttgacaatatgatatggcccctgcttcttcttgtaccctgtttcttgttgcccgggaccggggcgatctccttctacttgcgtcctctggggaaaaagtgcctgaaagaagaaattcataaagatgtgttggtgactggagagtatgaggtgtctgagcagcctggtctgacttgcgacctcaaggtaacagactccattggccacattctttattccaaggaagatgcaaggaagggcaaatttgcatttactactgatgataatgatgtgtatgaagtctgctttgtgagcaaaagtccatctgatacgctcagtttcacagaccaattaattgcccttgatataaagcatggcgtggaagcaaagaattataaagatgttgcagagacagagaaattgaagccacttgaagttgagcttagacgtttagaggatttaacacaatcggttgtgaaggacttttcttatatgaagaaaagagaagaagaaatgagggacactaatgaatcgaccagtctccgtgtactctactttagtgcgttctccatgttttgtcttgtggcccttgctacgtggcaagtcttttacttgagacatttcttcaaggcaaagaaacttattgagtgaattatgtatttaaattttaataggtcaccggtcactgtgtccatctgctgctgtgctgttttcagatggagggtctcaatttttcacaacaatttgtcaagttatacattcctacccacctcaatatggtcccccaaatacaaagttacatgtccgtaggtcaacgattcattttctgcccaattttctatcaagggatctttctgttttagaatgcattactgtactttgtgttgtaattgtctatagcgcacagtagaatggagattgtttacagtaactgccatagaaactggcatttagtatattatgaattattttatgcggtgtctgtaaaataagggaaagtgtgatttttatttaaataaattaaaagtgtcctttttatgtaaccgcaaatttattttattttttattttaatatggttaaccaaaaatgtatggtaaatgttaaatatgactggcttaaactaatcattattttcagtgcaaggaaaaaggcaattatttcataattataaaacataagggcttatttatcaaaattcgagtttgttttcctaaatcaaataaactggcatattgattggtcaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MIWPLLLLVPCFLLPGTGAISFYLRPLGKKCLKEEIHKDVLVTGEYEVSEQPGLTCDLKVTDSIGHILYSKEDARKGKFAFTTDDNDVYEVCFVSKSPSDTLSFTDQLIALDIKHGVEAKNYKDVAETEKLKPLEVELRRLEDLTQSVVKDFSYMKKREEEMRDTNESTSLRVLYFSAFSMFCLVALATWQVFYLRHFFKAKKLIE
Donor tissue: gastrula