ORFeome > tmem38a – XORFeome 2.0

tmem38a – XORFeome 2.0

General Information

Species: Xenopus tropicalis transmembrane protein 38A, mRNA (cDNA clone MGC:75707 IMAGE:5380689), complete cds
Gene Symbol: tmem38a
Gene ID: 394592
ORF gb_acc: MG132972
ORF ID: 10349

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061269

Library Location

Plate ID: GDExt11003
Well Location: C10

EST Sequences

Clone: MGC:75707 IMAGE:5380689
Trimmed Sequence: ATGGAGCTGTTATCTGCCCTCAGCCTAGATGACCTGGCTGTCGCATTCTCCAAATTGCCTGTTTTCCCTCTGTTTGATGTGGCATATTATATCATCTCCATTTTGTACCTGAAGTATGAACCAGGCGCAGTGGATCTTTCCAAACGCAGCCCAGTTGCCTCCTGGCTCTGTGCAATGCTCTACTGCTTTGGAAGCTACATTCTTGCAGATGTACTCTTAGGAGAGTCTCCCATTCACTACTTCAGCAATAATGCCAACATCCTTTTGGCCTCAGCTGTATGGTACTTGACTTTCTTCTGCCCCTTAAATATTTTCTACAAGATTGTTAGCTTCTTGCCTTTGAAGCTTGTCCTCGTTGGAATGAAGGAGGTGGTTCGCGTTCGCAAAATTGCCATGGGAATCCATCATGCCCACCATCACTACCATCATGGCTGGGTGATCATGGTACTGATTGGATGGGTAAAAGGCTCTGGAGTGGCCTTGATGTCTAACCTAGAGCAGCTCTTGCGTGGAGTCTGGAAGCCAGAGACAAATGAGATTCTCCATATGTCTTTTCCAACTAAGGCCAGTCTGTATGGAGCTATCTTGTTTACATTACAGCAGGCTCATTGGCTTCCCATCTCCAAAGCCTACCTTATCTTTTTCTTCACCCTCTTCATGGCAATTTGCAAGATCTACATGACAGCAACTCACTCTCATGGCTCCCCATTTGCTATATTTGAATCCGGTATCTGTTGTGTACTTTTTGGTGCTGCCAATGGTGACCATGATGACCATGGTGACCATCATCACCACCATGATGACCATGATGTGTCCCATTCAACTGTAAAATCCAAAGAGGAACTTAATGAGGGAACACGCAAGAGGAAAACAAAGAAAGCTGAGTAA
Full Trace Sequence: cttctgcatcttgctttgtctgcagccacagtgaggggacactagcacagcatggagctgttatctgccctcagcctagatgacctggctgtcgcattctccaaattgcctgttttccctctgtttgatgtggcatattatatcatctccattttgtacctgaagtatgaaccaggcgcagtggatctttccaaacgcagcccagttgcctcctggctctgtgcaatgctctactgctttggaagctacattcttgcagatgtactcttaggagagtctcccattcactacttcagcaataatgccaacatccttttggcctcagctgtatggtacttgactttcttctgccccttaaatattttctacaagattgttagcttcttgcctttgaagcttgtcctcgttggaatgaaggaggtggttcgcgttcgcaaaattgccatgggaatccatcatgcccaccatcactaccatcatggctgggtgatcatggtactgattggatgggtaaaaggctctggagtggccttgatgtctaacctagagcagctcttgcgtggagtctggaagccagagacaaatgagattctccatatgtcttttccaactaaggccagtctgtatggagctatcttgtttacattacagcaggctcattggcttcccatctccaaagcctaccttatctttttcttcaccctcttcatggcaatttgcaagatctacatgacagcaactcactctcatggctccccatttgctatatttgaatccggtatctgttgtgtactttttggtgctgccaatggtgaccatgatgaccatggtgaccatcatcaccaccatgatgaccatgatgtgtcccattcaactgtaaaatccaaagaggaacttaatgagggaacacgcaagaggaaaacaaagaaagctgagtaaaagtgggagaagacttcacagctctgtttaaagatttctttgaattaacataccagtctgcttacattggggttcctcacacctaatcaataatatttaccacattgcagtcaatgtgcatggtttcttagaggacattcacaagctgctttcacatctcatgatggttaaatactggttttttaagccattttattgcaggatcacattggtttcaaatgtggtcattcaatgtagaccatcaagattcttagtgatcacaggactggaactggcatggttataaaagaattctgcctcttaggtattaagactagcctgcctactgtatagtgatggtaatatcaggtatgagcaatatgagggcctcacgatgtttgattacaactcccagcatcccaaatatacactgtttgtggatgctgacagttttaattgaataacatctggaatatgtgacttaaacctgctttatattgatcaaaacaattagagtatgtaacaattaaatataaaaatattttacaatttgacaattattttgtaaactgatcatttaaaaatgaacacagaataaaaccactatatatttaacacaacatatttttttaaaaccagaaccctctgaaaaaggtatttttaaaatattctgttaaaaatgtatgttcataaataaaaatattaacaagtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MELLSALSLDDLAVAFSKLPVFPLFDVAYYIISILYLKYEPGAVDLSKRSPVASWLCAMLYCFGSYILADVLLGESPIHYFSNNANILLASAVWYLTFFCPLNIFYKIVSFLPLKLVLVGMKEVVRVRKIAMGIHHAHHHYHHGWVIMVLIGWVKGSGVALMSNLEQLLRGVWKPETNEILHMSFPTKASLYGAILFTLQQAHWLPISKAYLIFFFTLFMAICKIYMTATHSHGSPFAIFESGICCVLFGAANGDHDDHGDHHHHHDDHDVSHSTVKSKEELNEGTRKRKTKKAE
Donor tissue: tadpole