ORFeome > tnnc2 – XORFeome 2.0

tnnc2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis troponin C type 2 (fast), mRNA (cDNA clone MGC:75744 IMAGE:5381396), complete cds
Gene Symbol: tnnc2
Gene ID: 394554
ORF gb_acc: MG132926
ORF ID: 10293

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC061286

Library Location

Plate ID: GDExt11004
Well Location: F01

EST Sequences

Clone: MGC:75744 IMAGE:5381396
Trimmed Sequence: ATGCCTACAGACCAACAGCAAGATGCGAGGTCCTTCCTCAGCGAGGAAATGATTGCTGAGTTCAAGGCTGCCTTTGACATGTTTGACACTGATGGTGGCGGTGATATCAGCACCAAGGAGTTGGGAACTGTCATGAGGATGTTAGGACAGAACCCAACCAAGGAGGAGTTGGATGCCATCATTGAGGAAGTAGATGAGGATGGCAGCGGCACTATCGACTTTGAGGAGTTCTTGGTCATGATGGTGCGCCAGATGAAAGAGGATGCGCAGGGCAAAAGTGAAGAGGAGTTGGCTGAGTGCTTCCGCATTTTTGACAAGAATGCTGATGGGTACATTGATGGCGAGGAGTTAGCTGAAATCCTCCGTTCCTCAGGTGAGAGCATAACAGATGAGGAGATTGAGGAGCTTATGAAAGATGGAGACAAAAACAACGATGGCAAAATTGACTTTGATGAGTTCTTGAAGATGATGGAAGGTGTGCAGTAA
Full Trace Sequence: gtctgtacagaagaggaaacagatacctcctgccatccttctcctctgcaggcatttggggtgacctgccaagatgcctacagaccaacagcaagatgcgaggtccttcctcagcgaggaaatgattgctgagttcaaggctgcctttgacatgtttgacactgatggtggcggtgatatcagcaccaaggagttgggaactgtcatgaggatgttaggacagaacccaaccaaggaggagttggatgccatcattgaggaagtagatgaggatggcagcggcactatcgactttgaggagttcttggtcatgatggtgcgccagatgaaagaggatgcgcagggcaaaagtgaagaggagttggctgagtgcttccgcatttttgacaagaatgctgatgggtacattgatggcgaggagttagctgaaatcctccgttcctcaggtgagagcataacagatgaggagattgaggagcttatgaaagatggagacaaaaacaacgatggcaaaattgactttgatgagttcttgaagatgatggaaggtgtgcagtaagcagtaggacattcctctggagcgttgtgacgccaacctgtacattacactgcgtcttacttacatttcaggaaggagcaagtcatcctgctcttttactgtacctcccacaatcctcctcgcttctgatgtgtacattactctctatggccaccttgcatcctgcagagaacctcttaatccactgtttactatcaggctctctaccctcttcatcttcctgtttttctgactcatatgttatttataaaaaaaaaattacagttaccattaaaactcttagtgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MPTDQQQDARSFLSEEMIAEFKAAFDMFDTDGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAQGKSEEELAECFRIFDKNADGYIDGEELAEILRSSGESITDEEIEELMKDGDKNNDGKIDFDEFLKMMEGVQ
Donor tissue: tadpole