ORFeome > tpd52l2 – XORFeome 2.0

tpd52l2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis tpd52l2 protein, mRNA (cDNA clone MGC:97644 IMAGE:6980242), complete cds
Gene Symbol: tpd52l2
Gene ID: 595067
ORF gb_acc: MG134416
ORF ID: 12109

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC093461

Library Location

Plate ID: GDExt11021
Well Location: C08

EST Sequences

Clone: MGC:97644 IMAGE:6980242
Trimmed Sequence: ATGGAGCCCGGTGGGCAGGACATCAACCTTAACTCTCCCAACAAAGGTTTGCTGACAGACTATGGGGCTGATGTGCCAGTGCTGCCCGCGGGAGGCCACGCCCCTGCTGATGCCGCTGGGATGGCAGTGCCAGAGGGCCTGACAGAAGCCGAGACTGAAGAGCTGCACAGTGAGCTGCTGAAGGTGGAGGAGGAAATCAACACGCTGCGCCAGGTTCTGGCTGCCAAGGAGAGACATGCCGCGGAGCTGAAGAGAAAGCTCGGCCAGACCCCCCTCAACCAGCTGAAGATGAACTTGTCCAAGAGCCTCCAGGAGGTGCAGATGTCCAACGCTTATGTAAAAACATCAGAGAAATTTGGCGAATGGAACGAGAAAGTGACGCAGTCTGATGTCTACAAGAAGACGCAGGAGACGCTGTCGCAGGCAGGGCAGAAAACTTCCGCCGCTCTGTCCAACGTGGGCACCGCTATTACCCGCAGGCTGGGAGACATGAGCAGCTACTCTATCCGCCACTCCATAAGCATGCCCGCCATGAGGAATTCGCCCACCTTCAAGTCGTTTGAGGAGCGCGTGGGGAGCCTAAAGGGTCGGGTGTCCCTCGGAGGAGGAGAAAGCGGGAACTTTCACTCTCCGGATAACAATCCACAGGACTCCGCCCCCTTCTAG
Full Trace Sequence: cgacatggagcccggtgggcaggacatcaaccttaactctcccaacaaaggtttgctgacagactatggggctgatgtgccagtgctgcccgcgggaggccacgcccctgctgatgccgctgggatggcagtgccagagggcctgacagaagccgagactgaagagctgcacagtgagctgctgaaggtggaggaggaaatcaacacgctgcgccaggttctggctgccaaggagagacatgccgcggagctgaagagaaagctcggccagacccccctcaaccagctgaagatgaacttgtccaagagcctccaggaggtgcagatgtccaacgcttatgtaaaaacatcagagaaatttggcgaatggaacgagaaagtgacgcagtctgatgtctacaagaagacgcaggagacgctgtcgcaggcagggcagaaaacttccgccgctctgtccaacgtgggcaccgctattacccgcaggctgggagacatgagcagctactctatccgccactccataagcatgcccgccatgaggaattcgcccaccttcaagtcgtttgaggagcgcgtggggagcctaaagggtcgggtgtccctcggaggaggagaaagcgggaactttcactctccggataacaatccacaggactccgcccccttctagacccagaagaacacgattggtttccatcccagccactcccccttcctgttcccctggttctcaggctgggaatccctccgtttaaatggaaactgcaccttcatgaagaagtggccccatgacattatctgcatcactgctgctgcctgtagggggagcaagtcacatgggtggggccccattaaacatgcagctaaaacagccaataacctcctgctaatagcttttaaggggtggggacaactctgccgagctgagtgggtttaactagggggctatccgttatggcgacctaccctagtgggaggagcttggcagaaatgtgggtgggagatggagctctcttatgggaggtgcactgtgggtgtggcttgaaaaacgccagatagggagctattttgggagatgctaagtgggtggagctagggaggttgtgggaggagcttgattagactgagtttagaatactcatttcatatttatgtgagcggcacctcccacccaccgctgtgtgcttatgccctgtaggtgggaggagcttgaaggcaatatgccgctcaccagatttgcccatgtacccagactttcccctaaatacagcaactggcagcttcgttggtttagtttccctttaaacagcagatgcagtttctctgcgacacccccaacgtgatgtggaatcttccactatatagcgaggggggggggagattcaggctataaatcatctcgttccaattgaatacttccctaccggtgcccccggggcagtgggattgcccctgggtgtgcccccccccccccactcatgccaatagtctgtgaataggaaacactattaagcaaccggcgggcaccccccggggctcttattgatttgattttacccccggctcagcagagaaggggcaaatatcctgcaacttttctttctctgtgatacttgaactgcactgcttcccgagtggggccccagccgcccccgtgcaaacggctagagagatatatatatacggagaattctatccacccctgtagtgtcgctttgtactgctgccattccgtcggtgacagagagagggcgccagctgttactgctgggaattgtagttgaggtataggggcaataggtgagagcttcttgcccccaggggtaagtgtgtgtggcccccactctctgcattgtctgtaccaagcatcgttcctctatcactgtgtaacatataaccaaaggcatcgcatctggctgacacctgcactctccttactggggggcaatagcgggccccccgctagtttcaggcatgcaggttttatctacagaatgtgtttgtacaaccatggccgagggggaggggccacagctatgtaagtagctcctccctctctgtagggaggctctatcaataaagcatttaatagaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MEPGGQDINLNSPNKGLLTDYGADVPVLPAGGHAPADAAGMAVPEGLTEAETEELHSELLKVEEEINTLRQVLAAKERHAAELKRKLGQTPLNQLKMNLSKSLQEVQMSNAYVKTSEKFGEWNEKVTQSDVYKKTQETLSQAGQKTSAALSNVGTAITRRLGDMSSYSIRHSISMPAMRNSPTFKSFEERVGSLKGRVSLGGGESGNFHSPDNNPQDSAPF
Donor tissue: tailbud