ORFeome > tubb2b – XORFeome 2.0

tubb2b – XORFeome 2.0

General Information

Species: Xenopus tropicalis tubulin, beta 2B, mRNA (cDNA clone MGC:75628 IMAGE:5379398), complete cds
Gene Symbol: tubb2b
Gene ID: 394889
ORF gb_acc: MG132877
ORF ID: 10238

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064166

Library Location

Plate ID: GDExt11002
Well Location: G08

EST Sequences

Clone: MGC:75628 IMAGE:5379398
Trimmed Sequence: ATGCGTGAAATCGTGCACATCCAGGCTGGCCAGTGCGGTAACCAAATTGGAGCTAAATTTTGGGAAGTCATCAGTGATGAACACGGAATTGATCCTACAGGCAGTTACCATGGAGACAGTGATTTGCAACTAGAAAGGATCAACGTATATTACAATGAAGCCACAGGTAACAAATTTGTACCCCGTGCCATCCTTGTGGATTTGGAACCAGGCACAATGGATTCTGTCAGATCTGGGCCATTCGGGCAGATTTTCAGACCAGACAACTTTGTCTTTGGTCAGAGTGGTGCTGGCAATAACTGGGCCAAGGGTCATTACACGGAAGGAGCTGAGCTGGTGGACTCTGTTCTGGATGTGGTGAGAAAAGAAGCAGAGAGCTGTGACTGCCTACAAGGTTTTCAGTTGACCCATTCTCTGGGTGGTGGCACAGGCTCCGGCATGGGAACCCTGCTCATCAGTAAGATAAGGGAAGAGTACCCTGACCGAATCATGAATACATTCAGTGTGATGCCATCACCCAAAGTCTCAGACACTGTGGTTGAACCATACAATGCAACCCTTTCAGTTCATCAGTTGGTGGAAAACACAGATGAAACCTACTGCATAGACAATGAGGCCCTTTATGATATCTGCTTCCGCACTTTAAAGTTAACCACACCAACATATGGTGATCTTAATCATCTTGTATCTGCCACAATGAGTGGTGTAACAACCTGCCTTCGTTTCCCAGGCCAGCTTAATGCTGATTTACGCAAACTGGCTGTCAATATGGTGCCTTTCCCTCGACTGCACTTTTTTATGCCAGGGTTTGCCCCATTAACAAGTCGTGGCAGCCAGCAATACCGAGCCCTGACGGTGCCAGAACTAACACAGCAAATGTTCGATTCCAAGAACATGATGGCGGCATGTGATCCACGTCATGGACGCTACCTCACTGTGGCTGCTATCTTCCGTGGAAGAATGTCTATGAAAGAAGTTGATGAACAGATGCTCAATGTCCAGAACAAGAACAGCAGCTACTTTGTTGAATGGATTCCCAACAATGTGAAGACCGCAGTATGTGACATTCCACCAAGAGGCCTCAAAATGTCTGCAACCTTTATCGGTAACAGCACTGCCATTCAAGAGCTTTTCAAAAGAATCTCTGAGCAGTTCACTGCTATGTTCCGTCGCAAAGCTTTCTTGCACTGGTACACTGGCGAGGGCATGGATGAGATGGAGTTCACAGAAGCTGAAAGCAACATGAACGACTTGGTGTCAGAGTATCAGCAGTACCAAGATGCAACAGCTGATGAGCAAGGCGAGTTTGAGGAAGAGGAAGGGGAAGATGAAGCTTGA
Full Trace Sequence: gccggccagacaccataggggtgtgcacaaaggggcaagtaaagcaacaagaaagggctacaacatccactgatttacaccgcttataagaccaataccaatcaatcgtaaccatgcgtgaaatcgtgcacatccaggctggccagtgcggtaaccaaattggagctaaattttgggaagtcatcagtgatgaacacggaattgatcctacaggcagttaccatggagacagtgatttgcaactagaaaggatcaacgtatattacaatgaagccacaggtaacaaatttgtaccccgtgccatccttgtggatttggaaccaggcacaatggattctgtcagatctgggccattcgggcagattttcagaccagacaactttgtctttggtcagagtggtgctggcaataactgggccaagggtcattacacggaaggagctgagctggtggactctgttctggatgtggtgagaaaagaagcagagagctgtgactgcctacaaggttttcagttgacccattctctgggtggtggcacaggctccggcatgggaaccctgctcatcagtaagataagggaagagtaccctgaccgaatcatgaatacattcagtgtgatgccatcacccaaagtctcagacactgtggttgaaccatacaatgcaaccctttcagttcatcagttggtggaaaacacagatgaaacctactgcatagacaatgaggccctttatgatatctgcttccgcactttaaagttaaccacaccaacatatggtgatcttaatcatcttgtatctgccacaatgagtggtgtaacaacctgccttcgtttcccaggccagcttaatgctgatttacgcaaactggctgtcaatatggtgcctttccctcgactgcacttttttatgccagggtttgccccattaacaagtcgtggcagccagcaataccgagccctgacggtgccagaactaacacagcaaatgttcgattccaagaacatgatggcggcatgtgatccacgtcatggacgctacctcactgtggctgctatcttccgtggaagaatgtctatgaaagaagttgatgaacagatgctcaatgtccagaacaagaacagcagctactttgttgaatggattcccaacaatgtgaagaccgcagtatgtgacattccaccaagaggcctcaaaatgtctgcaacctttatcggtaacagcactgccattcaagagcttttcaaaagaatctctgagcagttcactgctatgttccgtcgcaaagctttcttgcactggtacactggcgagggcatggatgagatggagttcacagaagctgaaagcaacatgaacgacttggtgtcagagtatcagcagtaccaagatgcaacagctgatgagcaaggcgagtttgaggaagaggaaggggaagatgaagcttgatgacaaatgcatcctggcatttttagaaatcaaaaggcacagtttttaaatagctagagcatttgctcaggattttgttccagtatgtttcttcattttctattgtcattgataccacaatcaattttttgtaacctttacaaagtcaaagtaacagttgttgtttttagcatctcttctaacttttacaaaatgcccaaacatgattaggatgattgtagaagtgattttgaccactcttagatgtttttgcccattggataaaatcataaaagtatttgtgctcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKFVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA
Donor tissue: tailbud