ORFeome > tubb4 – XORFeome 2.0

tubb4 – XORFeome 2.0

General Information

Species: Xenopus tropicalis tubulin, beta 4, mRNA (cDNA clone MGC:69524 IMAGE:5336539), complete cds
Gene Symbol: tubb4
Gene ID: 394927
ORF gb_acc: MG134257
ORF ID: 11919

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC090613

Library Location

Plate ID: GDExt11018
Well Location: C11

EST Sequences

Clone: MGC:69524 IMAGE:5336539
Trimmed Sequence: ATGAGGGAAATCGTGCACCTGCAGGCGGGGCAGTGCGGAAACCAGATTGGAGCAAAGTTCTGGGAAGTTATCAGCGATGAGCATGGAATTGATCCTACAGGGACCTACCATGGAGACAGTGATCTGCAGCTGGAAAGAATTAATGTTTATTATAATGAAGCTTCAGGCGGAAAGTACGTTCCCAGGGCCGTTCTTGTTGACCTGGAGCCTGGTACAATGGACTCTGTTCGATCCGGCCCTTTTGGACAGATCTTTAGACCAGACAACTTCGTGTTTGGTCAGAGCGGTGCTGGGAACAACTGGGCCAAGGGTCACTACACAGAAGGTGCAGAGTTAGTGGACTCTGTTATGGATGTTGTAAGGAAGGAGTCTGAGAGCTGTGACTGTCTGCAGGGTTTCCAGCTCACCCACTCGTTAGGAGGGGGCACTGGTTCTGGAATGGGAACCCTGTTAATTAGCAAGATCCGTGAAGAGTACCCCGATCGAATTATGAATACCTTTAGTGTAGTGCCCTCCCCTAAAGTTTCCGACACTGTAGTGGAACCATACAATGCTACACTTTCTGTACACCAACTGGTAGAAAACACTGACGAAACCTACTGCATAGACAATGAGGCCCTCTATGATATCTGCTTCCGCACTCTCAAGCTGACCACCCCCACCTATGGTGACCTCAACCACCTGGTCAGTGCCACCATGAGTGGTGTCACCACCTGCCTTCGCTTCCCAGGGCAGCTTAATGCTGACCTTCGTAAGCTGGCTGTCAACATGGTACCCTTCCCACGTCTGCACTTCTTCATGCCAGGGTTTGCCCCATTAACCAGCCGAGGCAGTCAGCAGTATCGTTCACTGACAGTGCCAGAGCTAACCCAGCAGATGTTTGACTCCAAGAACATGATGGCCGCCTGTGACCCAAGGCACGGGCGATACCTGACAGTGGCTGCAGTCTTCCGTGGCCGCATGTCTATGAAGGAAGTAGATGAGCAGATGCTCAATGTCCAGAACAAGAACAGCAGCTACTTTGTAGAGTGGATACCCAACAACGTCAAAACAGCAGTGTGTGACATCCCACCCCGAGGCCTGAAAATGGCAGCCACCTTTATTGGCAACAGCACTGCCATCCAGGAGTTGTTTAAGCGCATCTCTGAGCAGTTTACGGCCATGTTCCGGCGCAAGGCCTTTTTGCATTGGTACACAGGAGAGGGGATGGACGAGATGGAGTTCACAGAGGCCGAAAGTAATATGAATGACCTGGTATCAGAATACCAACAGTACCAAGACGCCACAGCCGAGGAGGGAGAATTTGAAGAAGAGGCAGAGGAGGAAGTTGCCTAA
Full Trace Sequence: gtcatttttttttttctattggcgcggagaagcggacgataagaggccgacagtatgagggaaatcgtgcacctgcaggcggggcagtgcggaaaccagattggagcaaagttctgggaagttatcagcgatgagcatggaattgatcctacagggacctaccatggagacagtgatctgcagctggaaagaattaatgtttattataatgaagcttcaggcggaaagtacgttcccagggccgttcttgttgacctggagcctggtacaatggactctgttcgatccggcccttttggacagatctttagaccagacaacttcgtgtttggtcagagcggtgctgggaacaactgggccaagggtcactacacagaaggtgcagagttagtggactctgttatggatgttgtaaggaaggagtctgagagctgtgactgtctgcagggtttccagctcacccactcgttaggagggggcactggttctggaatgggaaccctgttaattagcaagatccgtgaagagtaccccgatcgaattatgaatacctttagtgtagtgccctcccctaaagtttccgacactgtagtggaaccatacaatgctacactttctgtacaccaactggtagaaaacactgacgaaacctactgcatagacaatgaggccctctatgatatctgcttccgcactctcaagctgaccacccccacctatggtgacctcaaccacctggtcagtgccaccatgagtggtgtcaccacctgccttcgcttcccagggcagcttaatgctgaccttcgtaagctggctgtcaacatggtacccttcccacgtctgcacttcttcatgccagggtttgccccattaaccagccgaggcagtcagcagtatcgttcactgacagtgccagagctaacccagcagatgtttgactccaagaacatgatggccgcctgtgacccaaggcacgggcgatacctgacagtggctgcagtcttccgtggccgcatgtctatgaaggaagtagatgagcagatgctcaatgtccagaacaagaacagcagctactttgtagagtggatacccaacaacgtcaaaacagcagtgtgtgacatcccaccccgaggcctgaaaatggcagccacctttattggcaacagcactgccatccaggagttgtttaagcgcatctctgagcagtttacggccatgttccggcgcaaggcctttttgcattggtacacaggagaggggatggacgagatggagttcacagaggccgaaagtaatatgaatgacctggtatcagaataccaacagtaccaagacgccacagccgaggagggagaatttgaagaagaggcagaggaggaagttgcctaaaccatatttacccattatatcattttgccaagacccctcccatttcccttctgtttttttcttttcattcaacatctcactccatttctgtgagaaacagcagagtctctgaataggcaatcaggagttgaactgttgtctgcccaagtaccattactgtaacgatcatctgtgcatttatgtcttatagcatcccaactgtctacccatagttagggaagcagcttgctcttaagaattccgtaaatggtattgccctacattgggcaactttgcaattgacgaccctcttaaactttctccctttattgtcagcagacttcctattcatgaatcactgccagacagtaagccagtgttgttatacagaatatctgagggactctagattttatttgcttttaagtggaattttacattttgtaaggtgaacagaagttttcccaaaagtgcagcacaagtagggaatgccgtgtagttatgtggttagcacccatttgccaatttccagtcgtattttctattctgctgcttcagaaggaggctctgctgccaacatttctcactgccagtgtccctaagaccattcccccttttgtgctgtagctgcttgcaagctcttctgctcgtagttccagcactgctaggggttaactgaaagcactctcctctcgttgtgtctgtgctaacagtaatgtcacaccttaagctcatgagcatgataacctttcctgtttccaacacgtgcgctgctgccacgttttactggttaccgagggctaaccagaatcgagaggaacagggtttccactacactgccttttgcagccaccagaatgataaatgtcagggaagaggttaagctgatagccctatgtgctgtttaacacagatgtggaatatactgagagggcagaatcttaatatttccaggatgcagatcagacggctgtgctgtccagaaagcttcatcctctcctacctctctgtgttctgtacagtttggttccgtgagtacatacatgtgatttgtgaatctgtggcctgagtcattgaacgtgtcgcacatggtggaagcacttaccctagcaaagtaatcatcatgtttgcacattacactactgaataaacgcctgtgctcaatcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaagggcggcggcacttccggacccaggcatgatggcggctcgcatggtgctgtctgcgtgtggcaaagccgttctgcccggcgtttgtgctgccagtctgcgctttgtgtcccggcccagtcctgctgcccgctggtgccccctgctgttccgggcatatgccacagaggccaagaagacttacgtgagggacaagccgcatgtgaacattggcaccattgggcatgtggatcatggcaagaccaccctgacagctgccattactaagatcctggcggaggcggggggcgcccagttcaagaagtacgaggagatagacaatgccccggaagagaaggcgcggggcatcactatcaatgcctcccacgtggaatatgccacggccaaccgccactacgcgcacacagactgccccgggcacgccgactatgtcaagaacatgatcacggggacgtcgcagatggacggctgtatcctggtagtcgctgccaccgatgggcagatgccccagacacgggagcacctcctgctggccaaacagatcggcgtgaccaacatcgtggtgtacataaataaggccgacgcggtggacgacaaggagatgttggacctggtggagctggaggtccgggagcttctgactgagttcggatacgacggtgagaacacgcccattatcactggctccgccctctgcgcgctggagaaccggaaccccgacattgggctgaactccatcatgacactgctggacgcagtcgacacctacatccccgtgcccccccgcgagctggacaagcccttcctgttgcccgtggaggccgtctactctatcccgggcagggggacggtggtaacgggaacgctggagcgggggatcatcaagaagggcgacgagtgcgaatttgttgggcgcaacaaacacatcaagtctgtagttacaggcattgagatgttccatcagaacctggaccgggcggaggcgggagacaacctcggcgcattggtcagagggttaaagagggaggatgtgaaacgcgggatggtcatgtccaaacccggatccatccggcctcatcagaagattcaggcccaggtttatatccttagtaaagaggaaggggggcgacacaagccgttcgtcagtaacttcctgcctgtgatgttctctctgacgtgggacatgtcctgtcgggtcaccttgccggctaataaggaaatggtgatgccgggagaggacaccgccctcacactgaccctccgacagccaatggtcttagaaataggtcagcgctttacccttcgggacgggaaccggaccatcggcaccggcctggtcactgaaatcttgcagatgacacacgatgacgaagcgaattggggaggctgaaccccacaaaatgaactattctgggggggaggatcctttcaatgaagagcagtccctattggctgaaagccgacagcagcacttagtgtctccccccacccccaaatctctgcccccctgtaacatattcccctccctcaataaaaccagagatttgggtttttttctaccagtaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVMDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA
Donor tissue: tailbud