ORFeome > txn2 – XORFeome 2.0

txn2 – XORFeome 2.0

General Information

Species: Xenopus tropicalis txn2 protein, mRNA (cDNA clone MGC:79505 IMAGE:6977070), complete cds
Gene Symbol: txn2
Gene ID: 493523
ORF gb_acc: MG133544
ORF ID: 11074

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC082341

Library Location

Plate ID: GDExt11011
Well Location: F01

EST Sequences

Clone: MGC:79505 IMAGE:6977070
Trimmed Sequence: ATGGCCCAACGCCTGTTCTTGAAGCGAGTTGTTGTTCCGTCTGTGAAAAGCCTAATCGCTCCAGCACCCTCTCTCTCCACTTGCCTCTCAAATGGCATACGATCACATGGACTCAAGACCCTGACCTCCTCTAGACTACATCCCCACTGTAACTTGAGGCCCATCTCCACCTCTACTCCATGCAGAGTTACATTCAACGTCCAGGATGCAGATGACTTTCAAGAGCGTGTTGTTGGCAGTGAGACACCTGTGGTGGTGGATTTCCATGCACAGTGGTGTGGGCCATGCAAAATTCTAGCTCCCCGATTGGAGAAGGTTGTTGCTAAGCAACAAGGAAAAGTTGTGATGGCAAAAGTGGATATAGATGACCATACTGACCTTGCTCTTGAATTTGAGGTCTCTGCTGTGCCCACGGTCCTGGCCATAAAAAATGGAGATGTTGTGGATAAGTTTGTGGGACTGAAGGATGAAGATCAGCTTGACGCTTTCCTGAAGAAACTCATTGGACCATAG
Full Trace Sequence: cttccggtgcatgtggaaccctccagcggtccctgaccagttcctccgcctgcctgaagaaagatggcccaacgcctgttcttgaagcgagttgttgttccgtctgtgaaaagcctaatcgctccagcaccctctctctccacttgcctctcaaatggcatacgatcacatggactcaagaccctgacctcctctagactacatccccactgtaacttgaggcccatctccacctctactccatgcagagttacattcaacgtccaggatgcagatgactttcaagagcgtgttgttggcagtgagacacctgtggtggtggatttccatgcacagtggtgtgggccatgcaaaattctagctccccgattggagaaggttgttgctaagcaacaaggaaaagttgtgatggcaaaagtggatatagatgaccatactgaccttgctcttgaatttgaggtctctgctgtgcccacggtcctggccataaaaaatggagatgttgtggataagtttgtgggactgaaggatgaagatcagcttgacgctttcctgaagaaactcattggaccatagtcagagcctctctgtctttatctgaaactgtgatcccaaggctggcgagttcaactcctggctgcctacctaagttcagcctctaccttgttacctcttgtctgcaatgaatgctttgcaatattttgtgtaatgaagggagaaggataagtttgtcattttcttgaatggacatggcttttgtgcttacattaatagcacttctgccctatcccactcctgctttataatttcttttctcccggttactgtgaacccaaatgtatttaatataggagaaatatgtcactatggcttcctaatatctacttttatgtgtttgttttgtttgaattcttggattttaggtacaagtcacttctttgaactcactggaagtccatttactgtatcctgttgaagagtgggtcagaaaagatattaacccgcacctgacaccatttacaacccaaccaactaaaagtgtcagattttttttttatatcaatctcaaactctgtggctgtgtcaccaagggaaaggtgacaagtggtttaaggctttactggaatctggactctccctgtaccataacctgcagaagtgacacttgctttgccactcaatacgcccaactcgagatcactaccctgcccaaactcttcagaggcactttctaccaactatgcaggatagtaatgttactgtgatgcattgagtatatagccaatatatatatacacatatgattttaatctaatatttaagaaatgaatgtatgttctttctttgcagagagtttgcttggtgtgaacacagataaaattagcaaattatattctcagtaaaccaagttaggactccagcaaatgtagaaataaaaatggaaagagtggtcagttttcactctgcctctctaattaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAQRLFLKRVVVPSVKSLIAPAPSLSTCLSNGIRSHGLKTLTSSRLHPHCNLRPISTSTPCRVTFNVQDADDFQERVVGSETPVVVDFHAQWCGPCKILAPRLEKVVAKQQGKVVMAKVDIDDHTDLALEFEVSAVPTVLAIKNGDVVDKFVGLKDEDQLDAFLKKLIGP
Donor tissue: tailbud