ORFeome > txndc5 – XORFeome 2.0

txndc5 – XORFeome 2.0

General Information

Species: Xenopus tropicalis thioredoxin domain containing 5, mRNA (cDNA clone MGC:75894 IMAGE:5383363), complete cds
Gene Symbol: txndc5
Gene ID: 394794
ORF gb_acc: MG133004
ORF ID: 10391

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC063355

Library Location

Plate ID: GDExt11005
Well Location: B01

EST Sequences

Clone: MGC:75894 IMAGE:5383363
Trimmed Sequence: ATGTTGCGGTTTCCGAGTGCTCTGTTGCTATGTGCGGTGCTAGCCAGGGTGTCAGGGGAGCCCTGGGAAGAAGGGGCAGATGAAGACCCGCATAAGAAGAACCTCTATACGGCCGATATGTTCGATCATGCCATCAAGCAAGAGCCGCACTTCATCATGTTCTTCGCTCCCTGGTGCGGTCATTGCCAGCGTTTGCAGCCCACTTGGAATGAGCTTGGGGACAAATACAACCGTATGTCAAAGACTCCAGCGTACATTGCCAAGGTTGACTGTACTACGGATATGCCCACATGCACTGAGCATGGCGTCAGAGGATACCCCACGCTAAAGCTGTTTAGACCAGGCCAAGAAGCTGTGAAGTACCAGGGACCCAGGGACTTGCAGAGTTTGGAAAACTGGATGCTCCAGACTCTAAATGATGAACCAGAAAAACCCAAGGTTGAAGAAAAAGTCGAAGAGCCTGCTAAAGTTCCAGAATTGAAACAAGGCCTGTATGAGCTTACTGCAGCCAACTTTAAGGAGCATATCGCAGAAGGAAACCATTTTATCAAATTCTTTGCACCTTGGTGTGGACACTGTAAAGCTCTGGCTCCTGCATGGGAACAGCTCGCAGCAACCTTCCAGGACTCTAATAGTATTAAAATCGCCAAGGTTGATTGCACTCAACATAATGGGCTGTGCTCTGATAACCAAGTGCGTGGATATCCTACACTGCTGTGGTTCAGGAATGGGGAAAAGGTTGACCAGTATAAGGGAAAGAGAGATCTGGATTCTCTGAAAGAATATGCCGAAAGCCAACTGAAACCCGCTGAAGAAAAAAAAGAGGAGGAACAGAAGGAGGATGCTACTCCACCGCAAGTAGAGAAGCCTGTGGCAGTGGAGTCCAAAGTCCTGTCTCTCAGTGAAAGCAACTTTGACCAGACTGTTGCTACAGGTGTCAGTTTTATTAAGTTCTACGCCCCCTGGTGTGGTCACTGTAAGAACCTAGTTCCAATATGGGAGGATCTCTCCAAAAAAGAATTTTCTGGAATGAGTGATGTTAAAATTGCCAAGGTTGACTGCACAGCTGAGCGTGCGCTCTGCAACAGATTCTCGGTGCGTGGTTACCCAACATTGCTGCTTTTCCGTGCAGGGGAAAAAATTGGTGAACATGAAGGCGCTAGAGATCTAGAAACACTACAAAACTTTGTCCTGCGTCATTCCAGGGATGAACTTTAA
Full Trace Sequence: gcctgatttgatcaggcctcactctctctctgtccctcttgcccggtaaagatgttgcggtttccgagtgctctgttgctatgtgcggtgctagccagggtgtcaggggagccctgggaagaaggggcagatgaagacccgcataagaagaacctctatacggccgatatgttcgatcatgccatcaagcaagagccgcacttcatcatgttcttcgctccctggtgcggtcattgccagcgtttgcagcccacttggaatgagcttggggacaaatacaaccgtatgtcaaagactccagcgtacattgccaaggttgactgtactacggatatgcccacatgcactgagcatggcgtcagaggataccccacgctaaagctgtttagaccaggccaagaagctgtgaagtaccagggacccagggacttgcagagtttggaaaactggatgctccagactctaaatgatgaaccagaaaaacccaaggttgaagaaaaagtcgaagagcctgctaaagttccagaattgaaacaaggcctgtatgagcttactgcagccaactttaaggagcatatcgcagaaggaaaccattttatcaaattctttgcaccttggtgtggacactgtaaagctctggctcctgcatgggaacagctcgcagcaaccttccaggactctaatagtattaaaatcgccaaggttgattgcactcaacataatgggctgtgctctgataaccaagtgcgtggatatcctacactgctgtggttcaggaatggggaaaaggttgaccagtataagggaaagagagatctggattctctgaaagaatatgccgaaagccaactgaaacccgctgaagaaaaaaaagaggaggaacagaaggaggatgctactccaccgcaagtagagaagcctgtggcagtggagtccaaagtcctgtctctcagtgaaagcaactttgaccagactgttgctacaggtgtcagttttattaagttctacgccccctggtgtggtcactgtaagaacctagttccaatatgggaggatctctccaaaaaagaattttctggaatgagtgatgttaaaattgccaaggttgactgcacagctgagcgtgcgctctgcaacagattctcggtgcgtggttacccaacattgctgcttttccgtgcaggggaaaaaattggtgaacatgaaggcgctagagatctagaaacactacaaaactttgtcctgcgtcattccagggatgaactttaaacccatcctgaaccctatgggtttgagatgccttactgggcaatgaagttactgaatatttttatatgcagtatggggtttaatacatgtgtcaaatttgggtgatttatcttggtgttttataacacagaaaaatggcaaagtcattgttgtaccttgtttgaacttttaggcaaatgtcacatctggtggtgtttctttcagtgcatagatgcctgaaactgcccaggccccttattaattttatggtaaccacatgtcaccaccggcataggtaggttttgcttgaatataaaaatttaatacaaaaatccaccagttgtgatattagccttaagcaatggtcaaggagagactacaaaatacctctcaggatttagtttcataccactatacaggacagtacctctcaatgagaactgtgatccacaggtattcttcaaaataatgacattccttctaactgcacttctagattttttttaatttactgtggatctggaatatgctgaagtgccttatttggtggaacgggctttaagaaaaggacgactgttattggtttgttgttgataacatggctcatagaagactgtacactgcaaaaattaaatcattttctattgtgtatctctgcaaataaccctttttttacctgatggaaaaatgtgatgatgaatccttacaaaatgtatttctttggtcattttgtattgttcagcatttccaacattttctcgttggcagtgcgactgtaccagtaaatacagctgagtggagaaaaaaaaaaaaaaaagaaataataaaaaaaaaaaaaaaaa
Translation: MLRFPSALLLCAVLARVSGEPWEEGADEDPHKKNLYTADMFDHAIKQEPHFIMFFAPWCGHCQRLQPTWNELGDKYNRMSKTPAYIAKVDCTTDMPTCTEHGVRGYPTLKLFRPGQEAVKYQGPRDLQSLENWMLQTLNDEPEKPKVEEKVEEPAKVPELKQGLYELTAANFKEHIAEGNHFIKFFAPWCGHCKALAPAWEQLAATFQDSNSIKIAKVDCTQHNGLCSDNQVRGYPTLLWFRNGEKVDQYKGKRDLDSLKEYAESQLKPAEEKKEEEQKEDATPPQVEKPVAVESKVLSLSESNFDQTVATGVSFIKFYAPWCGHCKNLVPIWEDLSKKEFSGMSDVKIAKVDCTAERALCNRFSVRGYPTLLLFRAGEKIGEHEGARDLETLQNFVLRHSRDEL
Donor tissue: neurula