ORFeome > ubc – XORFeome 2.0

ubc – XORFeome 2.0

General Information

Species: Xenopus tropicalis ubiquitin C, mRNA (cDNA clone MGC:69388 IMAGE:5335302), complete cds
Gene Symbol: ubc
Gene ID: 448120
ORF gb_acc:
ORF ID: 10776

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC074652

Library Location

Plate ID: GDExt11008
Well Location: B05

EST Sequences

Clone: MGC:69388 IMAGE:5335302
Trimmed Sequence: ATGCAGATATTTGTGAAAACGCTCACTGGGAAGACCATCACACTAGAAGTTGAGCCAAGTGACACTATTGAAAATGTGAAGGCTAAAATACAGGATAAAGAAGGCATTCCTCCAGATCAACAAAGGTTGATCTTTGCTGGCAAACAGCTGGAAGATGGCCGAACCTTATCAGACTATAACATCCAAAAGGAATCCACTCTGCATTTGGTTCTCCGTTTGAGAGGTGGGATGCAGATATTTGTGAAGACCCTGACTGGGAAGACCATTACCCTTGAGGTTGAGCCAAGTGATACTATTGAGAATGTAAAGGCAAAAATCCAAGACAAGGAAGGCATTCCCCCTGACCAGCAGAGATTGATTTTTGCTGGCAAGCAGCTGGAAGATGGTCGCACTCTTTCTGACTACAACATTCAAAAAGAATCCACCTTGCACTTAGTTCTTCGTCTCAGAGGTGGGATGCAAATATTTGTGAAGACCCTGACTGGTAAAACAATAACCCTTGAGGTTGAACCAAGTGACACAATTGAAAATGTAAAGGCGAAAATCCAAGATAAGGAAGGTATTCCTCCCGACCAGCAGAGATTGATCTTTGCTGGAAAGCAGCTGGAAGATGGCCGCACACTCTCTGATTACAACATTCAGAAAGAATCCACACTGCACTTGGTTCTTCGTCTCAGAGGTGGGATGCAGATTTTTGTCAAGACCCTGACTGGGAAGACCATTACTCTTGAAGTTGAGCCCAGTGACACAATTGAGAATGTGAAGGCAAAAATCCAAGATAAGGAAGGCATTCCCCCTGACCAGCAGAGGTTGATCTTTGCAGGCAAGCAGCTGGAAGATGGCAGAACCCTGTCAGATTACAATATTCAGAAAGAATCCACCCTACATTTGGTTCTTCGTCTCAGAGGTGGGATGCAGATATTTGTGAAGACCCTGACTGGGAAGACCATTACCCTTGAGGTTGAGCCAAGTGATACTATTGAGAATGTGAAGGCAAAAATCCAAGATAAGGAAGGCATTCCCCCTGACCAGCAGAGATTGATCTTTGCAGGCAAGCAGCTGGAAGATGGTCGCACTCTTTCTGACTACAACATTCAAAAAGAATCCACCTTGCACTTAGTTCTTCGTCTCAGAGGTGGGATGCAAATATTTGTGAAAACACTGACAGGGAAGACCATTACTCTTGAAGTAGAGCCAAGTGATACCATTGAGAATGTGAAGGCAAAAATCCAAGATAAGGAAGGAATCCCTCCTGACCAACAGAGATTGATTTTTGCTGGCAAGCAATTGGAAGATGGCAGAACCCTCTCAGACTACAATATTCAAAAAGAATCCACCCTGCACTTAGTTCTACGTCTCAGAGGTGGGATGCAAATATTTGTGAAGACCTTAACTGGTAAAACAATAACCCTTGAGGTTGAACCAAGTGACACCATTGAAAATGTAAAAGCAAAAATTCAAGACAAAGAAGGTATTCCTCCCGACCAGCAGAGATTGATCTTTGCCGGAAAGCAGCTGGAAGATGGCCGCACACTCTCTGATTACAACATTCAGAAAGAATCCACACTGCACTTGGTTCTTCGTCTCAGAGGTGGGATGCAGATTTTTGTCAAGACCCTGACTGGGAAGACCATTACTCTTGAAGTTGAGCCCAGTGACACAATTGAGAATGTAAAGGCAAAAATCCAAGATAAGGAAGGCATTCCCCCTGACCAGCAGAGATTGATCTTTGCAGGCAAGCAGCTGGAAGATGGCCGCACTCTCTCTGATTACAACATTCAGAAAGAATCCACCCTGCACCTGGTCCTGCGTTTGAGGGGTGGGGTTTAA
Full Trace Sequence: ctttagcaacggtgcagcttggaggtaactggttgagattcgtgcaggaccggatcggcagcaaacatgcagatatttgtgaaaacgctcactgggaagaccatcacactagaagttgagccaagtgacactattgaaaatgtgaaggctaaaatacaggataaagaaggcattcctccagatcaacaaaggttgatctttgctggcaaacagctggaagatggccgaaccttatcagactataacatccaaaaggaatccactctgcatttggttctccgtttgagaggtgggatgcagatatttgtgaagaccctgactgggaagaccattacccttgaggttgagccaagtgatactattgagaatgtaaaggcaaaaatccaagacaaggaaggcattccccctgaccagcagagattgatttttgctggcaagcagctggaagatggtcgcactctttctgactacaacattcaaaaagaatccaccttgcacttagttcttcgtctcagaggtgggatgcaaatatttgtgaagaccctgactggtaaaacaataacccttgaggttgaaccaagtgacacaattgaaaatgtaaaggcgaaaatccaagataaggaaggtattcctcccgaccagcagagattgatctttgctggaaagcagctggaagatggccgcacactctctgattacaacattcagaaagaatccacactgcacttggttcttcgtctcagaggtgggatgcagatttttgtcaagaccctgactgggaagaccattactcttgaagttgagcccagtgacacaattgagaatgtgaaggcaaaaatccaagataaggaaggcattccccctgaccagcagaggttgatctttgcaggcaagcagctggaagatggcagaaccctgtcagattacaatattcagaaagaatccaccctacatttggttcttcgtctcagaggtgggatgcagatatttgtgaagaccctgactgggaagaccattacccttgaggttgagccaagtgatactattgagaatgtgaaggcaaaaatccaagataaggaaggcattccccctgaccagcagagattgatctttgcaggcaagcagctggaagatggtcgcactctttctgactacaacattcaaaaagaatccaccttgcacttagttcttcgtctcagaggtgggatgcaaatatttgtgaaaacactgacagggaagaccattactcttgaagtagagccaagtgataccattgagaatgtgaaggcaaaaatccaagataaggaaggaatccctcctgaccaacagagattgatttttgctggcaagcaattggaagatggcagaaccctctcagactacaatattcaaaaagaatccaccctgcacttagttctacgtctcagaggtgggatgcaaatatttgtgaagaccttaactggtaaaacaataacccttgaggttgaaccaagtgacaccattgaaaatgtaaaagcaaaaattcaagacaaagaaggtattcctcccgaccagcagagattgatctttgccggaaagcagctggaagatggccgcacactctctgattacaacattcagaaagaatccacactgcacttggttcttcgtctcagaggtgggatgcagatttttgtcaagaccctgactgggaagaccattactcttgaagttgagcccagtgacacaattgagaatgtaaaggcaaaaatccaagataaggaaggcattccccctgaccagcagagattgatctttgcaggcaagcagctggaagatggccgcactctctctgattacaacattcagaaagaatccaccctgcacctggtcctgcgtttgaggggtggggtttaaaacaatcattatgcatctgctctgcattacttgcttgttgcactttgtttcaataaagctattgcattccaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV
Donor tissue: tailbud