ORFeome > ube2e3 – XORFeome 2.0

ube2e3 – XORFeome 2.0

General Information

Species: Xenopus tropicalis ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog), mRNA (cDNA clone MGC:76120 IMAGE:5308964), complete cds
Gene Symbol: ube2e3
Gene ID: 394925
ORF gb_acc: MG132745
ORF ID: 10048

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064216

Library Location

Plate ID: GDExt11001
Well Location: D04

EST Sequences

Clone: MGC:76120 IMAGE:5308964
Trimmed Sequence: ATGTCTAGTGATAGACAGCGCTCAGATGATGAAAGCCCTAGTACCAGTAGTGGAAGTTCAGATGCTGACCAGCGAGACCCACCAGCACCAGAACCTGAAGAGCAAGAAGAAAGAAAACCCTCGGCGGTCCAACAAAAGAAAAATACCAAACTGTCCAGTAAAACCACTGCTAAGCTGTCCACTAGTGCTAAAAGGATTCAGAAGGAGTTGGCTGAAATAACCCTTGATCCTCCTCCGAACTGCAGCGCTGGACCAAAGGGGGACAATATTTATGAATGGAGATCTACGATTCTTGGACCTCCAGGATCAGTATATGAGGGGGGTGTATTTTTCTTGGATATCACATTTTCATCTGATTATCCCTTTAAGCCACCAAAGGTCACTTTTCGCACCAGAATCTATCACTGTAATATTAACAGCCAGGGAGTAATCTGCTTGGATATTCTGAAAGATAACTGGAGTCCAGCATTGACTATATCAAAAGTTTTGCTATCTATTTGTTCCCTCTTGACAGACTGCAATCCCGCTGATCCACTGGTCGGAAGCATAGCCACTCAGTACCTGACCAACAGAGCCGAGCATGACAGGATAGCGAGACAGTGGACCAAGAGATATGCTACATAA
Full Trace Sequence: gttcggcagccggccggagcctgctcgtttccccggctctgcgttcccaggatctcccggcggcagcggcacacacagcggcgtgaggagagcagggaccggcgcgcccggaagattgcatccagaagaaacagaatccatcaagatgtctagtgatagacagcgctcagatgatgaaagccctagtaccagtagtggaagttcagatgctgaccagcgagacccaccagcaccagaacctgaagagcaagaagaaagaaaaccctcggcggtccaacaaaagaaaaataccaaactgtccagtaaaaccactgctaagctgtccactagtgctaaaaggattcagaaggagttggctgaaataacccttgatcctcctccgaactgcagcgctggaccaaagggggacaatatttatgaatggagatctacgattcttggacctccaggatcagtatatgaggggggtgtatttttcttggatatcacattttcatctgattatccctttaagccaccaaaggtcacttttcgcaccagaatctatcactgtaatattaacagccagggagtaatctgcttggatattctgaaagataactggagtccagcattgactatatcaaaagttttgctatctatttgttccctcttgacagactgcaatcccgctgatccactggtcggaagcatagccactcagtacctgaccaacagagccgagcatgacaggatagcgagacagtggaccaagagatatgctacataaactgtacagtgaaaagcacaaggcatctgtacaatgtgcaacaaatctttatagcctttacaatacggacttctgtgtatatgttatactgattctactctctgcttttatcctatgaagactggtatactgccccaaaaggtaaatactaagaagagtagaactttgtagctgtagattagtaatgttaaaatgcctacttgcaagtcttgcttctttgggatatcaaaatgtattttgtgatgtactaagaatactgttccaaaccaaatattatagtgcattttagcctaattcattatctgtatgaggttattaaagttagcagtagattactagaaattgtcatttgtattaaacccagaaatatttccaattatgtggtagacactgttgtgaaaactgttttaccttttgtcagtttgaactgaaaagatttcctttattcctttgtagctcagagagcacccaaatgtattatcccaaacacacaataaacatgttccctaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSSDRQRSDDESPSTSSGSSDADQRDPPAPEPEEQEERKPSAVQQKKNTKLSSKTTAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLTNRAEHDRIARQWTKRYAT
Donor tissue: gastrula