ORFeome > vps37b – XORFeome 2.0

vps37b – XORFeome 2.0

General Information

Species: Xenopus tropicalis vacuolar protein sorting 37 homolog B, mRNA (cDNA clone MGC:75912 IMAGE:5383631), complete cds
Gene Symbol: vps37b
Gene ID: 394642
ORF gb_acc: MG132996
ORF ID: 10380

ORF full-length analysis tests

Clone type: Putative Full Length
XGC accession: BC061362

Library Location

Plate ID: GDExt11005
Well Location: A02

EST Sequences

Clone: MGC:75912 IMAGE:5383631
Trimmed Sequence: ATGGCCGTCGAAACGATCAAGTTTATGCACTTGTCCCTCTCTGAGCTGAACGAACTGCTGGAAGATGAGGAGAAGCTGGGGCACATAGTGCAAGAGATGGACGAGCCTCAGAATGTTCAGTTGAGCAAAGAAATGACACTTGCTGGAAATCGCAGCCTTGCAGAGGGGAACCTGCTATTGCAACCAGATCTTGAAACCTTAAAAGCCACCCTGACACAAAAATACCAGGAGCTGCAAAGTCTCATAGAGTCCCACCAGTTGAAGAAAACAAAACTTGATAAACAGTCTGTCAATTCATCCCTGGAAACCCTTTTAGCTCTTCTTCAGGCTGAAGGTGCCAAAATAGAGGAGGAGACAGAGAATATGGCAGAAAATTTCCTTGATGGAGGCATCCAGTTGGATAACTTCACTGATGAGTATATGAACAAACGCAAATTAGCCCATCTGCGACGTGTAAAAATTGAAAAACTTCAGGAGATGGTAATGAAGGGGCAAAGACTTCCCCAGGTATCTGTGCTGCCACAAGCAGGGCCTTCGGAAACAAACCAAGCACCTCAAGCTCCCTATCCAACAAACTTCGCCACTCCTCTACCTGTTACACCCAGAAGACCAGTGCCACCGCCACCCCAAGCGCCAAGTCAACCTGGACTATATCCAATGCCATATGCAATGGGTGCTCAGCCAGCCCATGGGCTGCCTTATGCAGCATCTCCGTGCCCACCTATTCCTTCTCGTCATGGGTATCAGCCTTCAAATCAAATGCCTCAGCCTGGTTATCCAGTTCCATTCACAACACAGTATCCTCCTGCTCTCCCTCAAAGACCACCTCGCCTTCCTCCTATGCCCGGTTTCATTACACAGTGA
Full Trace Sequence: gccattctaggcgctgagaagcgagtggcgagggggtgaagctgcctattgggtgacaggccgacagagtgagagccctttcccccgggggttagctgaccatggccgtcgaaacgatcaagtttatgcacttgtccctctctgagctgaacgaactgctggaagatgaggagaagctggggcacatagtgcaagagatggacgagcctcagaatgttcagttgagcaaagaaatgacacttgctggaaatcgcagccttgcagaggggaacctgctattgcaaccagatcttgaaaccttaaaagccaccctgacacaaaaataccaggagctgcaaagtctcatagagtcccaccagttgaagaaaacaaaacttgataaacagtctgtcaattcatccctggaaacccttttagctcttcttcaggctgaaggtgccaaaatagaggaggagacagagaatatggcagaaaatttccttgatggaggcatccagttggataacttcactgatgagtatatgaacaaacgcaaattagcccatctgcgacgtgtaaaaattgaaaaacttcaggagatggtaatgaaggggcaaagacttccccaggtatctgtgctgccacaagcagggccttcggaaacaaaccaagcacctcaagctccctatccaacaaacttcgccactcctctacctgttacacccagaagaccagtgccaccgccaccccaagcgccaagtcaacctggactatatccaatgccatatgcaatgggtgctcagccagcccatgggctgccttatgcagcatctccgtgcccacctattccttctcgtcatgggtatcagccttcaaatcaaatgcctcagcctggttatccagttccattcacaacacagtatcctcctgctctccctcaaagaccacctcgccttcctcctatgcccggtttcattacacagtgaaatgtaacgtgtgcctcactggaagattggtgctgtctgtttcacgcctcctcttttattctcttatctggatgtctataagagttgctcatattgtaatgtgcagctggtaccagaaaactcttcttataaatgacctgtactttttaaaaaaaattatttagagtcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MAVETIKFMHLSLSELNELLEDEEKLGHIVQEMDEPQNVQLSKEMTLAGNRSLAEGNLLLQPDLETLKATLTQKYQELQSLIESHQLKKTKLDKQSVNSSLETLLALLQAEGAKIEEETENMAENFLDGGIQLDNFTDEYMNKRKLAHLRRVKIEKLQEMVMKGQRLPQVSVLPQAGPSETNQAPQAPYPTNFATPLPVTPRRPVPPPPQAPSQPGLYPMPYAMGAQPAHGLPYAASPCPPIPSRHGYQPSNQMPQPGYPVPFTTQYPPALPQRPPRLPPMPGFITQ
Donor tissue: neurula