ORFeome > wdr68 – XORFeome 2.0

wdr68 – XORFeome 2.0

General Information

Species: Xenopus tropicalis WD repeat domain 68, mRNA (cDNA clone MGC:75622 IMAGE:5379367), complete cds
Gene Symbol: wdr68
Gene ID: 394701
ORF gb_acc: MG132838
ORF ID: 10188

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC062486

Library Location

Plate ID: GDExt11003
Well Location: A05

EST Sequences

Clone: MGC:75622 IMAGE:5379367
Trimmed Sequence: ATGTCCCTGCACGGGAAAAGGAAGGAGATTTATAAGTACGAGGCGCCATGGACCGTCTATGCTATGAACTGGAGTGTGAGGCCGGACAAGAGGTTCCGCTTGGCGTTGGGGAGCTTTGTTGAGGAATATAACAATAAGGTACAGCTAGTAGGACTGGATGAAGAGAGCTCTGAATTCATTTGCCGAAACACATTTGATCACCCGTATCCTACAACAAAGCTTATGTGGATCCCCGACACTAAAGGAGTATATCCAGATCTGTTAGCCACCAGCGGGGATTACCTCCGTGTCTGGAGGGTTGGAGAGACGGAGACCCGTCTGGAGTGTTTGCTAAACAACAACAAGAACTCTGATTTCTGTGCCCCCCTCACCTCATTTGATTGGAATGAAGTAGACCCCAACCTGCTGGGAACCTCAAGTATTGATACAACATGCACAATCTGGGGTTTGGAGACTGGACAGGTCCTTGGCAGGGTTAATCTGGTGTCTGGACATGTGAAAACGCAGCTCATTGCCCATGACAAAGAGGTCTATGACATTGCATTCAGCCGTGCAGGAGGGGGCAGAGACATGTTTGCCTCTGTGGGGGCAGATGGCTCTGTGCGAATGTTTGACTTGCGCCACCTGGAGCACAGTACAATCATCTATGAAGACCCCCAACATCATCCATTACTTCGACTGTGTTGGAACAAGCAGGATCCGAACTATCTGGCAACCATGGCCATGGATGGAATGGAGGTGGTAATCTTGGATGTACGAGTACCTTGTACCCCAGTAGCCAGACTTAACAACCACCGTGCTTGTGTCAATGGCATTGCATGGGCACCCCATTCATCTTGCCACATCTGTACTGCAGCGGATGATCACCAGGCCCTAATCTGGGATATTCAGCAGATGCCAAGAGCGATTGAGGATCCCATATTGGCATACACAGCAGAGGGAGAAATCAACAATGTGCAGTGGGCAAGCACCCAGCCTGACTGGATTGCCATTTGTTACAACAACTGCCTGGAGATCCTGCGAGTGTAA
Full Trace Sequence: cgcctgcgtatctgcttctacaaggcttcggcgatcgtgtcccggtaaccgtgttagcaaagcagctccagccatgtccctgcacgggaaaaggaaggagatttataagtacgaggcgccatggaccgtctatgctatgaactggagtgtgaggccggacaagaggttccgcttggcgttggggagctttgttgaggaatataacaataaggtacagctagtaggactggatgaagagagctctgaattcatttgccgaaacacatttgatcacccgtatcctacaacaaagcttatgtggatccccgacactaaaggagtatatccagatctgttagccaccagcggggattacctccgtgtctggagggttggagagacggagacccgtctggagtgtttgctaaacaacaacaagaactctgatttctgtgcccccctcacctcatttgattggaatgaagtagaccccaacctgctgggaacctcaagtattgatacaacatgcacaatctggggtttggagactggacaggtccttggcagggttaatctggtgtctggacatgtgaaaacgcagctcattgcccatgacaaagaggtctatgacattgcattcagccgtgcaggagggggcagagacatgtttgcctctgtgggggcagatggctctgtgcgaatgtttgacttgcgccacctggagcacagtacaatcatctatgaagacccccaacatcatccattacttcgactgtgttggaacaagcaggatccgaactatctggcaaccatggccatggatggaatggaggtggtaatcttggatgtacgagtaccttgtaccccagtagccagacttaacaaccaccgtgcttgtgtcaatggcattgcatgggcaccccattcatcttgccacatctgtactgcagcggatgatcaccaggccctaatctgggatattcagcagatgccaagagcgattgaggatcccatattggcatacacagcagagggagaaatcaacaatgtgcagtgggcaagcacccagcctgactggattgccatttgttacaacaactgcctggagatcctgcgagtgtaactgtatttattccctacccttctagcccactcttcctacccctttcctacaggatcttctgctcctcaaggcctccggtttttatacatctgaacttattggctcaccttcctgtctgcgatgtaagccagaagatcctcattatcctccagtaccttattggctgtaactactaaacattcttgtccatccagataaacggagtcctctgcctgtttttacagtatgtgattcaactcttttacatgaaggaattagtgctgcttagtaaatcgggccctggtttataattgacaacacaagaaaaggggttcccttccttagtccgttccctgtactttgccccgagtgtatttcagttgttgggagatgggggggggggggccgggttgtgggtgggatggtaactattgtactgtaatattacctgtgtatactatcctcatatatgtgtgtatttgtagtgctgacatgctgtttctatatattgtctgatattaaaggagtatcaggttccctaaaaaaaaaaaaaaaaaaaaaa
Translation: MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPNLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
Donor tissue: tailbud