ORFeome > ythdf1 – XORFeome 2.0

ythdf1 – XORFeome 2.0

General Information

Species: Xenopus tropicalis YTH domain family, member 1, mRNA (cDNA clone MGC:75606 IMAGE:5379253), complete cds
Gene Symbol: ythdf1
Gene ID: 395029
ORF gb_acc: MG132781
ORF ID: 10099

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064856

Library Location

Plate ID: GDExt11002
Well Location: F03

EST Sequences

Clone: MGC:75606 IMAGE:5379253
Trimmed Sequence: ATGTCTGCTACTAGCGTGGATCCCCAGCGACCAAAGGGACAAGACAGTAAAGTTCAAAACGGATCCCTGCACCAGAAGGACAGCGTGCACGATAATGACTTCGAGCAGTACCTGTCGGGACAGTCCAATCAGAGTAACAGCTACCCTTCCATGACCGACCCGTACCTGTCCAGTTACTACCCTCCTTCTATCGGCTTTCCGTATTCGCTCAGCGAAGCTCCTTGGTCAACCGGCGGGGACCCCCCGATCCCGTACCTCACCCCGTACGGACAGCTCAGCAACGGAGACCACCATTTCATGCACGATGCGGTCTTTGGGCAGCCCGGCGGCCTGGGGAATAACATCTATCAGCACCGGTTCAACTTCTTCCCGGAAAACCCGGCCTTTTCCGCATGGGGGACGAGCGGCTCCCAGGGGCAGCAGACCCAGAACTCCGCCTACGGGGGCAGTTACAGTTACCCACCAAGTTCCTTGGGCGGGACCATAGTGGACGGACAGACCGGGTTTCACAATGAAACTCTGAACAAAGCCCCCGGTATGAACAGCATTGAGCAGGGCATGGTGGGCCTTAAGATCGGGAGTAACGTCACCGCTTCCGCCGTAAAGACGGTGGGCTCTGTGGTTAACAGCGTGGGGATGCCCAGCGCTCTGTCCGGCAATGGCGGCACTAGCATAAGCATGCCCCCCTCCAAACCCACGTCCTGGGCGGCCATCGCCAGCAAACCGGCCAAGCCGCAGCCCAAAGCAAAAACTAAACCAGTCACTATAATCGGAGGGGCCCTCCCACCTCCCCCGATCAAGCATAACATGGACATAGGTACTTGGGACAATAAAGGACCCGTGGCTAAGCCCCCGATGCCGCAACAAATCCCGTCCCCCCAGTCCATGCCTCCGCCTCAACCTCAGCTGCTGCAGCCAATCCCGGCTCAGCCTCCACCAATGTCTCAGACTCCGTACCAAAACCCACCGCCCCCTCAGCAGCAGCCACAGGCCCCTCAGAACCGCTGGGTGGCCCCACGGAACAGGAACGCTGCTTACGGCCAGGGCGGAGGCCCGGACGGGAACCCTCTGGGCGGGGCTCAGTCTCACTCCGCCCCTGGGAACGAGTCCCACCCCGTGCTGGAGAAACTGAAGGCCGCCCACAGCTACAACCCCAAGGACTTTGACTGGAACCTGAAAAACGGGCGCGTGTTCATAATAAAGAGCTACTCCGAGGACGACATCCACCGCTCCATCAAGTACTCCATCTGGTGCAGCACAGAGCACGGCAACAAGCGCCTGGATAGCGCCTTCCGCTCCATGAACGGCAAGGGCCCCGTCTACCTTCTGTTCAGCGTCAACGGCAGCGGACACTTCTGCGGCGTGGCCGAGATGAAGTCCCCCGTGGACTACGGCACCAGTGCGGGCGTCTGGTCGCAGGACAAGTGGAAGGGCAAGTTCGACGTCAAGTGGCTCTTCGTCAAGGACGTTCCCAACAACCAGCTGAGGCACATCCGCCTGGAGAACAACGACAACAAACCGGTCACAAACTCGCGCGACACGCAGGAGGTGCCCTTAGAAAAAGCAAAACTGGTGCTCAAAATCATTGCCACTTACAAGCACACGACCTCCATCTTTGATGACTTTTCTCATTACGAGAAGCGGCAGGAAGAGGAAGAGGTCGTGCGCAAGGTAATGGCTAAACCCGACTCTTGCTAG
Full Trace Sequence: tgaagcctgttccctcccgggccagaaccgaagcagcggggctctccgtccgaaccgaacctccccgcaccgccgcgactccccgggccctcgcctgcctcctccatccgaggcctacacccgctcctgggcctcgacctgcactgaggccccggcctgcccagccccttgcgtctcccggacccgctcttcatgaaggatgtctgctactagcgtggatccccagcgaccaaagggacaagacagtaaagttcaaaacggatccctgcaccagaaggacagcgtgcacgataatgacttcgagcagtacctgtcgggacagtccaatcagagtaacagctacccttccatgaccgacccgtacctgtccagttactaccctccttctatcggctttccgtattcgctcagcgaagctccttggtcaaccggcggggaccccccgatcccgtacctcaccccgtacggacagctcagcaacggagaccaccatttcatgcacgatgcggtctttgggcagcccggcggcctggggaataacatctatcagcaccggttcaacttcttcccggaaaacccggccttttccgcatgggggacgagcggctcccaggggcagcagacccagaactccgcctacgggggcagttacagttacccaccaagttccttgggcgggaccatagtggacggacagaccgggtttcacaatgaaactctgaacaaagcccccggtatgaacagcattgagcagggcatggtgggccttaagatcgggagtaacgtcaccgcttccgccgtaaagacggtgggctctgtggttaacagcgtggggatgcccagcgctctgtccggcaatggcggcactagcataagcatgcccccctccaaacccacgtcctgggcggccatcgccagcaaaccggccaagccgcagcccaaagcaaaaactaaaccagtcactataatcggaggggccctcccacctcccccgatcaagcataacatggacataggtacttgggacaataaaggacccgtggctaagcccccgatgccgcaacaaatcccgtccccccagtccatgcctccgcctcaacctcagctgctgcagccaatcccggctcagcctccaccaatgtctcagactccgtaccaaaacccaccgccccctcagcagcagccacaggcccctcagaaccgctgggtggccccacggaacaggaacgctgcttacggccagggcggaggcccggacgggaaccctctgggcggggctcagtctcactccgcccctgggaacgagtcccaccccgtgctggagaaactgaaggccgcccacagctacaaccccaaggactttgactggaacctgaaaaacgggcgcgtgttcataataaagagctactccgaggacgacatccaccgctccatcaagtactccatctggtgcagcacagagcacggcaacaagcgcctggatagcgccttccgctccatgaacggcaagggccccgtctaccttctgttcagcgtcaacggcagcggacacttctgcggcgtggccgagatgaagtcccccgtggactacggcaccagtgcgggcgtctggtcgcaggacaagtggaagggcaagttcgacgtcaagtggctcttcgtcaaggacgttcccaacaaccagctgaggcacatccgcctggagaacaacgacaacaaaccggtcacaaactcgcgcgacacgcaggaggtgcccttagaaaaagcaaaactggtgctcaaaatcattgccacttacaagcacacgacctccatctttgatgacttttctcattacgagaagcggcaggaagaggaagaggtcgtgcgcaaggtaatggctaaacccgactcttgctagaaacctaaatgcttgcccccgccccctgccccgcccaccctccccgtctggctgcttggcgcctaaatccgggggaggaagtcacgattccattaaaggagaagttcacgtttgaaccaacttgttctgtgatgtagacattgatattctaagacgatttcccatttttgtttttttttttttggctaatttttctgtccgctcctatccagttgcccccctctccttattcatctcctttttttctgttatcgatgccactgcctggttgctagggcaaggtgtcatcctagcaaccgactatgtttaaattgctaactgcagattaaaagattgattcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MSATSVDPQRPKGQDSKVQNGSLHQKDSVHDNDFEQYLSGQSNQSNSYPSMTDPYLSSYYPPSIGFPYSLSEAPWSTGGDPPIPYLTPYGQLSNGDHHFMHDAVFGQPGGLGNNIYQHRFNFFPENPAFSAWGTSGSQGQQTQNSAYGGSYSYPPSSLGGTIVDGQTGFHNETLNKAPGMNSIEQGMVGLKIGSNVTASAVKTVGSVVNSVGMPSALSGNGGTSISMPPSKPTSWAAIASKPAKPQPKAKTKPVTIIGGALPPPPIKHNMDIGTWDNKGPVAKPPMPQQIPSPQSMPPPQPQLLQPIPAQPPPMSQTPYQNPPPPQQQPQAPQNRWVAPRNRNAAYGQGGGPDGNPLGGAQSHSAPGNESHPVLEKLKAAHSYNPKDFDWNLKNGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRSMNGKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVKWLFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKLVLKIIATYKHTTSIFDDFSHYEKRQEEEEVVRKVMAKPDSC
Donor tissue: tailbud