ORFeome > znf668 – XORFeome 2.0

znf668 – XORFeome 2.0

General Information

Species: Xenopus tropicalis zinc finger protein 668, mRNA (cDNA clone MGC:76080 IMAGE:5307865), complete cds
Gene Symbol: znf668
Gene ID: 394947
ORF gb_acc: MG132749
ORF ID: 10052

ORF full-length analysis tests

Clone type: Full Length
XGC accession: BC064196

Library Location

Plate ID: GDExt11001
Well Location: A08

EST Sequences

Clone: MGC:76080 IMAGE:5307865
Trimmed Sequence: ATGACTTCCACCAAGAGCGAGGCCGGCGCGGAGGTGAAGGACGAGCCCGAGGCGCCCAAGTTCGTGCAGGCCGGCCGACGCTATCGCTGCTTAAACTGCCACAAGACTTTCCCCAACCAGCCGCGTGCCCGGCGCCACTGCGAGGCCAATCATGCCGACAGGTCCCCCAGCTCACCCAATACGAAGAAACGGGCGGCGCGGTGCGAGCGGCGGCACCAGTGTGGGCACTGCAACAAGTCGTACAAGTCGGCCTCCCTGCTGCGCAGTCACGCCCGCAGCCATACGGGGGAGAAACCCTTCACCTGCAAGGAGTGCGGCCGTTCCTTTATGCAGCCGATCTGCCTGAAAGTGCATATGGCCACCCACAGCGGCCAGCTGCCCTTCCCCTGTGAGCACTGTGGGAAAGCCTACGCTACGCCTTCCAAGCTGCGCATTCACCAGAGACTCCATACTGGAGAGCGGCCCTTTTCCTGCCCAGACTGTGGCAAAGGCTTCGCCGACCCCTCTGTGTTCCGCAAGCACATGCGTAGCCACGCCGGATTGCGCCCGTATCAGTGCCAGCAGTGTGACAAGTCCTACAGTGAGCTGAAGGATCTGAAGAACCACGAGCGCAGCCACACCGGAGAGAAACCCTTCCTGTGCTCCGACTGCGGCAAGGCCTTCTCCCGCGCCTCCTCGCTCACATGCCACCTACGCATCCACGCCGCGGAGAAGCCTTACAAGTGCGCCACCTGTGGCAAAGACTTTACCCAGCTGTCTTCATACCAGAGCCACCAACGCACACACTCCGGGGAGAAGCCTTACTTGTGTCCCCAGTGTGGCAGAATGTTCTCCGACCCATCCAGTTTCCGCCGGCACCAACGGGCCCACCAGGGAGTCAAGCCGTACCAGTGCGACAAATGCGGGAAACCCTTCCGGCAGCCGGCGGACTTGGCGATGCACCAGCGCATCCACACTGGCGAGAGGCCTTTCCGCTGCCCGGACTGCGATAAGACCTTTGTGGCGTCTTGGGATCTGAAGCGCCACCGGCTGTCTCACAGCAGCGAGAGACCCTTCCAGTGCCAAGAATGTGGCAAAGGTTTTGCCGAGAGATCCGGGCTGAGTAAACACCAGCGCTCTCACAGCGGGGAGCGACCGTATAAATGCTCGGAGTGCGGGAAAAGCTTTGTGGTCTCCTCCAGCCTGAGGAAGCACGAGCGCACCCACCAGAAACCCGAGCACGATGCCACCAAAAGGAGAGAAGAGACCACCACGTGCGAGAAATGTTCCCTCAGCTTCCCCAGCATGATGGACCTGCGCAACCACCAGAAAACCCACCCGGAGCTGCGCCCCTTCCGCTGCGATCAGTGCGAGAAGGGATTTGTGGACAGGGCGGGACTGAAGAAGCACCAGCGGATACATAGCGACGTGCGCCCCTACGTCTGCTCCACCTGCGGGAAGGGCTTTCTGGTTCCCTCCGACCTGCGGAAGCACCAGCGGACACACAGCAAAGAGGTGAAGGAAAAGGAAGAAGAGGAGGAGGAAGAGATAACCACCCTGACCCTCCATCCTGCATCTGTAGAACCGCCCCCTCTCTATGATCCCTTGGTGTCCTTCCTGGAGAAGGTAGCAGAGGGAAACATGGAGGTGATCGACCCTTCTCCCTCAAACTGA
Full Trace Sequence: ggcagtgacaggagccagaaccttcacacaatgacttccaccaagagcgaggccggcgcggaggtgaaggacgagcccgaggcgcccaagttcgtgcaggccggccgacgctatcgctgcttaaactgccacaagactttccccaaccagccgcgtgcccggcgccactgcgaggccaatcatgccgacaggtcccccagctcacccaatacgaagaaacgggcggcgcggtgcgagcggcggcaccagtgtgggcactgcaacaagtcgtacaagtcggcctccctgctgcgcagtcacgcccgcagccatacgggggagaaacccttcacctgcaaggagtgcggccgttcctttatgcagccgatctgcctgaaagtgcatatggccacccacagcggccagctgcccttcccctgtgagcactgtgggaaagcctacgctacgccttccaagctgcgcattcaccagagactccatactggagagcggcccttttcctgcccagactgtggcaaaggcttcgccgacccctctgtgttccgcaagcacatgcgtagccacgccggattgcgcccgtatcagtgccagcagtgtgacaagtcctacagtgagctgaaggatctgaagaaccacgagcgcagccacaccggagagaaacccttcctgtgctccgactgcggcaaggccttctcccgcgcctcctcgctcacatgccacctacgcatccacgccgcggagaagccttacaagtgcgccacctgtggcaaagactttacccagctgtcttcataccagagccaccaacgcacacactccggggagaagccttacttgtgtccccagtgtggcagaatgttctccgacccatccagtttccgccggcaccaacgggcccaccagggagtcaagccgtaccagtgcgacaaatgcgggaaacccttccggcagccggcggacttggcgatgcaccagcgcatccacactggcgagaggcctttccgctgcccggactgcgataagacctttgtggcgtcttgggatctgaagcgccaccggctgtctcacagcagcgagagacccttccagtgccaagaatgtggcaaaggttttgccgagagatccgggctgagtaaacaccagcgctctcacagcggggagcgaccgtataaatgctcggagtgcgggaaaagctttgtggtctcctccagcctgaggaagcacgagcgcacccaccagaaacccgagcacgatgccaccaaaaggagagaagagaccaccacgtgcgagaaatgttccctcagcttccccagcatgatggacctgcgcaaccaccagaaaacccacccggagctgcgccccttccgctgcgatcagtgcgagaagggatttgtggacagggcgggactgaagaagcaccagcggatacatagcgacgtgcgcccctacgtctgctccacctgcgggaagggctttctggttccctccgacctgcggaagcaccagcggacacacagcaaagaggtgaaggaaaaggaagaagaggaggaggaagagataaccaccctgaccctccatcctgcatctgtagaaccgccccctctctatgatcccttggtgtccttcctggagaaggtagcagagggaaacatggaggtgatcgacccttctccctcaaactgaatggggaacgttccggcacctcgtgttcttggctcacttgcctgtaatgtatgtagccagtctcgctgaaactggccagaaggggcaaatgagtgttatgggcagctgctccacccaccttaatttggctcctccctgcctaatactgtgtcatgtatcctcacaatgttccttctctattctgcatcgacaccatgtaaataaatgcaaacgtgctgccgcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
Translation: MTSTKSEAGAEVKDEPEAPKFVQAGRRYRCLNCHKTFPNQPRARRHCEANHADRSPSSPNTKKRAARCERRHQCGHCNKSYKSASLLRSHARSHTGEKPFTCKECGRSFMQPICLKVHMATHSGQLPFPCEHCGKAYATPSKLRIHQRLHTGERPFSCPDCGKGFADPSVFRKHMRSHAGLRPYQCQQCDKSYSELKDLKNHERSHTGEKPFLCSDCGKAFSRASSLTCHLRIHAAEKPYKCATCGKDFTQLSSYQSHQRTHSGEKPYLCPQCGRMFSDPSSFRRHQRAHQGVKPYQCDKCGKPFRQPADLAMHQRIHTGERPFRCPDCDKTFVASWDLKRHRLSHSSERPFQCQECGKGFAERSGLSKHQRSHSGERPYKCSECGKSFVVSSSLRKHERTHQKPEHDATKRREETTTCEKCSLSFPSMMDLRNHQKTHPELRPFRCDQCEKGFVDRAGLKKHQRIHSDVRPYVCSTCGKGFLVPSDLRKHQRTHSKEVKEKEEEEEEEITTLTLHPASVEPPPLYDPLVSFLEKVAEGNMEVIDPSPSN
Donor tissue: gastrula